close

SimulationCraft 815-02

for World of Warcraft 8.2.0 PTR (wow build level 30329)

Current simulator hotfixes

Death Knight

Tag Spell / Effect Field Hotfixed Value DBC Value
2019-05-15 Real Procs Per Minute data removed from Killing Machine.
Killing Machine rppm 4.50 0.00
2019-03-12 Incorrect cooldown for Magus of the Dead's Frostbolt.
Frostbolt cooldown 3000.00 0.00

Mage

Tag Spell / Effect Field Hotfixed Value DBC Value
2018-12-28 Manually set Arcane Orb's travel speed.
Arcane Orb prj_speed 20.00 0.00
2018-05-02 Incorrect spell level for Icicle buff.
Icicles spell_level 78.00 80.00
2017-11-08 Incorrect spell level for Ignite.
Ignite spell_level 78.00 99.00
2017-11-06 Incorrect spell level for Icicle.
Icicle spell_level 78.00 80.00
2017-06-21 Ice Lance is slower than spell data suggests.
Ice Lance prj_speed 47.00 50.00
2017-03-20 Manually set Frozen Orb's travel speed.
Frozen Orb prj_speed 20.00 0.00

Shaman

Tag Spell / Effect Field Hotfixed Value DBC Value
2019-01-07 Incorrect Maelstrom generation value for Chain Lightning Overloads.
Fulmination (effect#6) base_value 2.00 3.00

Table of Contents

Raid Summary

 

Created with Highcharts 4.2.3 Damage per Second45,490 (13.37%)43,233 (7.74%)42,778 (6.61%)41,754 (4.06%)41,749 (4.04%)41,030 (2.25%)40,838 (1.77%)40,720 (1.48%)40,126visionslucid dreamsblood of the enemyfocusing irisunbound forcepurification protocolworldveinripple in spacebaselucid dreams Damage per Second: 43,233.0

Actions per Minute / DPS Variance Summary

base : 40126 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
40125.7 40125.7 19.7 / 0.049% 4866.7 / 12.1% 4831.6
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.3 8.2 Astral Power 0.00% 58.5 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Stellar Flare (Balance Druid)
  • 100: Shooting Stars (Balance Druid)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
base 40126
Heed My Call 296 (423) 0.7% (1.1%) 8.2 33.18sec 15468 0 Direct 8.2 9127 18255 10822 18.6%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.18 8.18 0.00 0.00 0.0000 0.0000 88505.80 88505.80 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.66 81.43% 9127.01 8921 9813 9124.52 0 9813 60779 60779 0.00
crit 1.52 18.57% 18254.95 17842 19626 14368.30 0 19626 27727 27727 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 127 0.3% 8.2 33.18sec 4646 0 Direct 8.2 3911 7825 4646 18.8%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.18 8.18 0.00 0.00 0.0000 0.0000 37996.14 37996.14 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.64 81.23% 3911.42 3823 4206 3910.50 0 4206 25983 25983 0.00
crit 1.54 18.77% 7824.92 7646 8411 6220.83 0 8411 12013 12013 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 5914 14.8% 78.3 3.74sec 22597 17402 Direct 78.3 19036 38068 22597 18.7%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 78.33 78.33 0.00 0.00 1.2985 0.0000 1770079.87 1770079.87 0.00 17402.01 17402.01
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 63.68 81.29% 19036.13 10135 24211 19043.73 18360 20083 1212184 1212184 0.00
crit 14.66 18.71% 38067.67 20270 48422 38081.50 33053 42602 557895 557895 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 2866 7.1% 14.0 21.43sec 61046 60870 Direct 14.0 3287 6575 3902 18.7%  
Periodic 223.8 3024 6043 3588 18.7% 99.3%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.05 14.05 223.77 223.77 1.0029 1.3292 857601.57 857601.57 0.00 2752.92 60870.29
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.42 81.27% 3286.65 2981 4065 3288.69 3015 3573 37526 37526 0.00
crit 2.63 18.73% 6574.85 5963 8130 6227.92 0 8130 17298 17298 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 182.0 81.33% 3023.68 6 3785 3025.02 2937 3151 550255 550255 0.00
crit 41.8 18.67% 6042.93 51 7570 6045.24 5600 6514 252524 252524 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Shooting Stars 921 2.3% 44.7 6.57sec 6169 0 Direct 44.7 5197 10390 6169 18.7%  

Stats details: shooting_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.66 44.66 0.00 0.00 0.0000 0.0000 275484.00 275484.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.30 81.29% 5197.29 4769 6503 5199.59 4876 5626 188673 188673 0.00
crit 8.36 18.71% 10390.08 9539 13006 10392.44 0 13006 86811 86811 0.00
 
 

Action details: shooting_stars

Static Values
  • id:202497
  • school:astral
  • resource:none
  • range:50000.0
  • travel_speed:0.8000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating ${$202497m2/10} Astral Power.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.360000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Solar Wrath 3309 (5266) 8.3% (13.1%) 95.5 3.08sec 16493 18336 Direct 96.1 8690 17368 10310 18.7%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 95.55 96.05 0.00 0.00 0.8995 0.0000 990305.55 990305.55 0.00 18335.78 18335.78
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 78.12 81.33% 8689.82 7949 10838 8694.92 8373 9201 678864 678864 0.00
crit 17.93 18.67% 17367.87 15898 21676 17376.68 15898 19489 311442 311442 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (solar_empowerment) 1957 4.9% 75.4 3.89sec 7766 0 Direct 75.4 7766 0 7766 0.0%  

Stats details: solar_empowerment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 75.40 75.40 0.00 0.00 0.0000 0.0000 585563.46 585563.46 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.40 100.00% 7766.13 5962 16257 7770.12 6781 9130 585563 585563 0.00
 
 

Action details: solar_empowerment

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:5961.69
  • base_dd_max:5961.69
  • base_dd_mult:1.00
 
Starsurge 13756 34.3% 62.1 4.88sec 66287 63464 Direct 61.9 56002 111931 66502 18.8%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 62.07 61.87 0.00 0.00 1.0445 0.0000 4114484.05 4114484.05 0.00 63463.78 63463.78
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 50.26 81.23% 56002.37 51347 69612 56026.20 53839 59600 2814410 2814410 0.00
crit 11.61 18.77% 111931.43 102695 139223 111966.61 102695 135005 1300074 1300074 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Stellar Flare 1861 4.6% 12.8 23.57sec 43569 42788 Direct 12.8 2790 5584 3309 18.6%  
Periodic 221.4 1960 3915 2325 18.7% 98.4%

Stats details: stellar_flare

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.78 12.78 221.36 221.36 1.0183 1.3322 556965.45 556965.45 0.00 1808.88 42787.54
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.41 81.41% 2789.72 2570 3504 2790.48 2570 3044 29034 29034 0.00
crit 2.38 18.59% 5583.76 5140 7009 5187.32 0 7009 13266 13266 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 180.0 81.31% 1959.50 11 2453 1960.38 1903 2051 352688 352688 0.00
crit 41.4 18.69% 3915.40 13 4906 3917.03 3687 4292 161977 161977 0.00
 
 

Action details: stellar_flare

Static Values
  • id:202347
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
Spelldata
  • id:202347
  • name:Stellar Flare
  • school:astral
  • tooltip:Suffering $w2 Astral damage every $t2 sec.
  • description:Burns the target for {$s1=0} Astral damage, and then an additional $o2 damage over {$d=24 seconds}. |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.125000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.087500
  • base_td:0.00
  • base_td_mult:0.82
  • dot_duration:24.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Streaking Star (s) 5932 14.7% 90.8 3.08sec 19434 0 Direct 90.8 16386 32773 19434 18.6%  

Stats details: streaking_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 90.85 90.85 0.00 0.00 0.0000 0.0000 1765517.51 1765517.51 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.95 81.40% 16386.26 16021 17623 16385.84 16021 17272 1211808 1211808 0.00
crit 16.90 18.60% 32772.71 32042 35246 32772.90 32042 35032 553709 553709 0.00
 
 

Action details: streaking_stars

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 3187 7.9% 17.7 16.86sec 53731 52832 Direct 17.7 4501 8992 5339 18.7%  
Periodic 222.9 3248 6489 3853 18.7% 99.0%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.75 17.75 222.94 222.94 1.0171 1.3301 953663.40 953663.40 0.00 3031.52 52831.61
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.44 81.34% 4500.64 4112 5607 4501.44 4198 4852 64972 64972 0.00
crit 3.31 18.66% 8992.40 8225 11214 8751.75 0 11214 29789 29789 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 181.3 81.34% 3247.69 4 4065 3249.15 3160 3407 588917 588917 0.00
crit 41.6 18.66% 6489.26 28 8130 6491.56 6094 7307 269985 269985 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Simple Action Stats Execute Interval
base
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:base
  • harmful:false
  • if_expr:
 
Berserking 2.0 182.70sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.0 182.53sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.9032 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:251837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:base
  • harmful:false
  • if_expr:
 
Bountiful Captain's Feast (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:259410
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:base
  • harmful:false
  • if_expr:
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Battle Potion of Intellect (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:279151
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 7.3 54.6 43.7sec 4.9sec 93.18% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:base
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:11.93%
  • arcanic_pulsar_2:10.45%
  • arcanic_pulsar_3:11.12%
  • arcanic_pulsar_4:10.64%
  • arcanic_pulsar_5:13.68%
  • arcanic_pulsar_6:10.79%
  • arcanic_pulsar_7:10.76%
  • arcanic_pulsar_8:13.82%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 187.5sec 0.0sec 16.24% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:base
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.24%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Battle-Scarred Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:base
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Berserking 2.0 0.0 182.7sec 182.7sec 8.12% 7.54% 0.0(0.0) 2.0

Buff details

  • buff initial source:base
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:base
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast) 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:base
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Celestial Alignment 8.3 0.0 37.5sec 37.5sec 26.10% 32.64% 0.0(0.0) 8.1

Buff details

  • buff initial source:base
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:26.10%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Conch of Dark Whispers 4.3 1.2 60.9sec 45.5sec 23.66% 0.00% 1.2(1.2) 4.0

Buff details

  • buff initial source:base
  • cooldown name:buff_conch_of_dark_whispers
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Conch of Dark Whispers

Stat Buff details

  • stat:crit_rating
  • amount:913.59

Stack Uptimes

  • conch_of_dark_whispers_1:23.66%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271071
  • name:Conch of Dark Whispers
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc271072=Your spells have a chance to grant you {$271071s1=649} Critical Strike for {$271071d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:base
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Ignition Mage's Fuse 3.0 0.0 120.3sec 120.3sec 19.24% 0.00% 2.8(2.8) 2.8

Buff details

  • buff initial source:base
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:366.08

Stack Uptimes

  • ignition_mages_fuse_1:3.95%
  • ignition_mages_fuse_2:3.90%
  • ignition_mages_fuse_3:3.85%
  • ignition_mages_fuse_4:3.79%
  • ignition_mages_fuse_5:3.74%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lunar Empowerment 34.8 46.6 8.7sec 3.7sec 82.20% 99.73% 1.9(1.9) 0.0

Buff details

  • buff initial source:base
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:35.92%
  • lunar_empowerment_2:31.92%
  • lunar_empowerment_3:14.37%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Moonkin Form 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:base
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Nature's Balance 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 399.0(399.0) 0.0

Buff details

  • buff initial source:base
  • cooldown name:buff_natures_balance
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.75

Stack Uptimes

  • natures_balance_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202430
  • name:Nature's Balance
  • tooltip:Grants $m3 Astral Power every $m4 sec while in combat or while below 50 Astral Power.
  • description:While in combat you generate $m3 Astral Power every $m4 sec. While out of combat your Astral Power rebalances to 50 instead of depleting to empty.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Overwhelming Power 4.6 3.5 64.3sec 33.8sec 47.90% 0.00% 3.5(48.4) 0.0

Buff details

  • buff initial source:base
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.38%
  • overwhelming_power_2:1.42%
  • overwhelming_power_3:1.45%
  • overwhelming_power_4:1.49%
  • overwhelming_power_5:1.54%
  • overwhelming_power_6:1.58%
  • overwhelming_power_7:1.62%
  • overwhelming_power_8:1.67%
  • overwhelming_power_9:1.71%
  • overwhelming_power_10:1.76%
  • overwhelming_power_11:1.81%
  • overwhelming_power_12:1.87%
  • overwhelming_power_13:1.92%
  • overwhelming_power_14:1.98%
  • overwhelming_power_15:2.04%
  • overwhelming_power_16:2.09%
  • overwhelming_power_17:2.16%
  • overwhelming_power_18:2.22%
  • overwhelming_power_19:2.29%
  • overwhelming_power_20:2.36%
  • overwhelming_power_21:2.43%
  • overwhelming_power_22:2.51%
  • overwhelming_power_23:2.59%
  • overwhelming_power_24:2.66%
  • overwhelming_power_25:1.35%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Solar Empowerment 25.2 52.6 11.8sec 3.9sec 85.49% 78.63% 0.2(0.2) 0.0

Buff details

  • buff initial source:base
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:28.26%
  • solar_empowerment_2:39.84%
  • solar_empowerment_3:17.38%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starlord 15.3 46.8 20.2sec 4.9sec 97.89% 92.85% 16.6(16.6) 11.4

Buff details

  • buff initial source:base
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:13.91%
  • starlord_2:22.49%
  • starlord_3:61.49%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.3 1.2 61.1sec 45.6sec 23.70% 0.00% 1.2(1.2) 4.1

Buff details

  • buff initial source:base
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.70%

Trigger Attempt Success

  • trigger_pct:99.98%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
base
starsurge Astral Power 62.1 2482.8 40.0 40.0 1657.2
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 96.55 772.32 (31.58%) 8.00 0.06 0.01%
celestial_alignment Astral Power 2.00 80.00 (3.27%) 40.00 0.00 0.00%
sunfire Astral Power 17.75 53.25 (2.18%) 3.00 0.00 0.00%
shooting_stars Astral Power 44.66 178.63 (7.31%) 4.00 0.00 0.00%
moonfire Astral Power 14.05 42.15 (1.72%) 3.00 0.00 0.00%
stellar_flare Astral Power 12.78 102.27 (4.18%) 8.00 0.00 0.00%
lunar_strike Astral Power 78.33 939.94 (38.44%) 12.00 0.06 0.01%
natures_balance Astral Power 400.01 200.00 (8.18%) 0.50 0.00 0.00%
arcanic_pulsar Astral Power 6.40 76.74 (3.14%) 12.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 8.16 8.29
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 19.55 0.00 69.00
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data base Fight Length
Count 15384
Mean 299.63
Minimum 240.01
Maximum 359.99
Spread ( max - min ) 119.97
Range [ ( max - min ) / 2 * 100% ] 20.02%
DPS
Sample Data base Damage Per Second
Count 15384
Mean 40125.74
Minimum 35927.07
Maximum 45978.90
Spread ( max - min ) 10051.83
Range [ ( max - min ) / 2 * 100% ] 12.53%
Standard Deviation 1247.4579
5th Percentile 38159.76
95th Percentile 42267.28
( 95th Percentile - 5th Percentile ) 4107.52
Mean Distribution
Standard Deviation 10.0575
95.00% Confidence Intervall ( 40106.03 - 40145.45 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 38
0.1% Error 3713
0.1 Scale Factor Error with Delta=300 13285
0.05 Scale Factor Error with Delta=300 53137
0.01 Scale Factor Error with Delta=300 1328421
Priority Target DPS
Sample Data base Priority Target Damage Per Second
Count 15384
Mean 40125.74
Minimum 35927.07
Maximum 45978.90
Spread ( max - min ) 10051.83
Range [ ( max - min ) / 2 * 100% ] 12.53%
Standard Deviation 1247.4579
5th Percentile 38159.76
95th Percentile 42267.28
( 95th Percentile - 5th Percentile ) 4107.52
Mean Distribution
Standard Deviation 10.0575
95.00% Confidence Intervall ( 40106.03 - 40145.45 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 38
0.1% Error 3713
0.1 Scale Factor Error with Delta=300 13285
0.05 Scale Factor Error with Delta=300 53137
0.01 Scale Factor Error with Delta=300 1328421
DPS(e)
Sample Data base Damage Per Second (Effective)
Count 15384
Mean 40125.74
Minimum 35927.07
Maximum 45978.90
Spread ( max - min ) 10051.83
Range [ ( max - min ) / 2 * 100% ] 12.53%
Damage
Sample Data base Damage
Count 15384
Mean 11996166.81
Minimum 9321412.30
Maximum 14960899.52
Spread ( max - min ) 5639487.22
Range [ ( max - min ) / 2 * 100% ] 23.51%
DTPS
Sample Data base Damage Taken Per Second
Count 15384
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data base Healing Per Second
Count 15384
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data base Healing Per Second (Effective)
Count 15384
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data base Heal
Count 15384
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data base Healing Taken Per Second
Count 15384
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data base Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data baseTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data base Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
E 1.00 potion,if=buff.ca_inc.remains>6&active_enemies=1
0.00 potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
0.00 blood_fury,if=buff.ca_inc.up
F 2.00 berserking,if=buff.ca_inc.up
0.00 arcane_torrent,if=buff.ca_inc.up
0.00 lights_judgment,if=buff.ca_inc.up
0.00 fireblood,if=buff.ca_inc.up
0.00 ancestral_call,if=buff.ca_inc.up
0.00 use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
0.00 use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
0.00 use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
0.00 use_item,name=tidestorm_codex,if=equipped.165576
G 2.95 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams
0.00 purifying_blast
0.00 ripple_in_space
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
H 2.00 celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
0.00 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
I 2.95 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
0.00 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
J 62.07 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
K 2.68 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
L 3.12 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
M 14.83 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
N 10.93 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
O 12.78 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
P 78.69 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Q 95.80 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
R 0.23 sunfire

Sample Sequence

0123456789ACDJNMOHFGJQJQPQJQPQPJQMQPNQPQJOJQPJPQPQPQPQJMQJQPQPLIJQPJQPJOQPJMQPQPQPJNQPJQPJMOQPPQQIJQJQJQLPPJMPPJOPQQJPQQQJMNPQJPQPQPOJPJQPGQJQKNPQJPQQQQPJPJMOQPQJPNPJQPQQPQJMPJPOQJQPQJQPNQMQQJPQHEFJQJQPJOQPNQJMQPQPJQPJPPQJQPJOQKNPPQJPQJPQQJPMQQQPNOQPJJPGQPQJMQPQJQPPQNQOPJQJQJQPKPJPPQJPQQQJP

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask base 58.0/100: 58% astral_power
Pre precombat 1 food base 58.0/100: 58% astral_power
Pre precombat 2 augmentation base 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 9 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power battle_potion_of_intellect
0:00.000 default J starsurge Fluffy_Pillow 66.0/100: 66% astral_power battle_potion_of_intellect
0:01.239 default N moonfire Fluffy_Pillow 26.5/100: 27% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:02.165 default M sunfire Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:03.091 default O stellar_flare Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:04.017 default H celestial_alignment Fluffy_Pillow 42.5/100: 43% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:04.823 default F berserking Fluffy_Pillow 83.0/100: 83% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:04.823 default G use_items Fluffy_Pillow 83.0/100: 83% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:04.823 default J starsurge Fluffy_Pillow 83.0/100: 83% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect, ignition_mages_fuse
0:05.578 default Q solar_wrath Fluffy_Pillow 43.5/100: 44% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), battle_potion_of_intellect, ignition_mages_fuse
0:06.333 default J starsurge Fluffy_Pillow 52.0/100: 52% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), battle_potion_of_intellect, ignition_mages_fuse
0:07.088 default Q solar_wrath Fluffy_Pillow 12.5/100: 13% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse
0:07.845 default P lunar_strike Fluffy_Pillow 21.0/100: 21% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse
0:08.690 default Q solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse
0:09.445 default J starsurge Fluffy_Pillow 42.0/100: 42% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:10.200 default Q solar_wrath Fluffy_Pillow 6.5/100: 7% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:10.955 default P lunar_strike Fluffy_Pillow 19.0/100: 19% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.765 default Q solar_wrath Fluffy_Pillow 31.5/100: 32% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.518 default P lunar_strike Fluffy_Pillow 40.0/100: 40% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.327 default J starsurge Fluffy_Pillow 52.5/100: 53% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(3)
0:14.081 default Q solar_wrath Fluffy_Pillow 17.0/100: 17% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse(3)
0:14.836 default M sunfire Fluffy_Pillow 25.5/100: 26% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.592 default Q solar_wrath Fluffy_Pillow 33.0/100: 33% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.350 default P lunar_strike Fluffy_Pillow 41.5/100: 42% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.129 default N moonfire Fluffy_Pillow 54.0/100: 54% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(4)
0:17.885 default Q solar_wrath Fluffy_Pillow 57.5/100: 57% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(4)
0:18.640 default P lunar_strike Fluffy_Pillow 66.0/100: 66% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.467 default Q solar_wrath Fluffy_Pillow 78.5/100: 79% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.223 default J starsurge Fluffy_Pillow 87.0/100: 87% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.978 default O stellar_flare Fluffy_Pillow 47.5/100: 48% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, battle_potion_of_intellect, ignition_mages_fuse(5)
0:21.734 default J starsurge Fluffy_Pillow 56.0/100: 56% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, battle_potion_of_intellect, ignition_mages_fuse(5)
0:22.488 default Q solar_wrath Fluffy_Pillow 16.5/100: 17% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), battle_potion_of_intellect, ignition_mages_fuse(5)
0:23.242 default P lunar_strike Fluffy_Pillow 29.0/100: 29% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), ignition_mages_fuse(5)
0:24.058 default J starsurge Fluffy_Pillow 42.0/100: 42% astral_power bloodlust, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment, starlord(2), ignition_mages_fuse(5)
0:24.813 default P lunar_strike Fluffy_Pillow 10.5/100: 11% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment(2), starlord(3), ignition_mages_fuse(5)
0:25.724 default Q solar_wrath Fluffy_Pillow 23.0/100: 23% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3)
0:26.478 default P lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3)
0:27.593 default Q solar_wrath Fluffy_Pillow 44.0/100: 44% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3)
0:28.346 default P lunar_strike Fluffy_Pillow 52.5/100: 53% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3)
0:29.461 default Q solar_wrath Fluffy_Pillow 65.5/100: 66% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment(3), starlord(3)
0:30.216 default P lunar_strike Fluffy_Pillow 74.0/100: 74% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3)
0:31.330 default Q solar_wrath Fluffy_Pillow 86.5/100: 87% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment(3), starlord(3)
0:32.085 default J starsurge Fluffy_Pillow 95.0/100: 95% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment(2), starlord(3)
0:32.961 default M sunfire Fluffy_Pillow 67.5/100: 68% astral_power bloodlust, celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), conch_of_dark_whispers
0:33.723 default Q solar_wrath Fluffy_Pillow 71.0/100: 71% astral_power bloodlust, celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), conch_of_dark_whispers
0:34.476 default J starsurge Fluffy_Pillow 79.5/100: 80% astral_power bloodlust, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers
0:35.239 default Q solar_wrath Fluffy_Pillow 40.0/100: 40% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), conch_of_dark_whispers
0:35.994 default P lunar_strike Fluffy_Pillow 48.5/100: 49% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), conch_of_dark_whispers
0:36.964 default Q solar_wrath Fluffy_Pillow 61.5/100: 62% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), conch_of_dark_whispers
0:37.717 default P lunar_strike Fluffy_Pillow 74.0/100: 74% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers
0:38.687 default L moonfire Fluffy_Pillow 86.5/100: 87% astral_power bloodlust, arcanic_pulsar, celestial_alignment, solar_empowerment(2), starlord(3), conch_of_dark_whispers
0:39.450 default I cancel_buff Fluffy_Pillow 90.0/100: 90% astral_power bloodlust, arcanic_pulsar, solar_empowerment(2), starlord(3), overwhelming_power(25), conch_of_dark_whispers
0:39.450 default J starsurge Fluffy_Pillow 90.0/100: 90% astral_power bloodlust, arcanic_pulsar, solar_empowerment(2), overwhelming_power(25), conch_of_dark_whispers
0:40.321 default Q solar_wrath Fluffy_Pillow 50.5/100: 51% astral_power bloodlust, arcanic_pulsar(2), lunar_empowerment, solar_empowerment(3), starlord, overwhelming_power(24), conch_of_dark_whispers
0:41.075 default P lunar_strike Fluffy_Pillow 59.0/100: 59% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord, overwhelming_power(23), conch_of_dark_whispers
0:42.485 default J starsurge Fluffy_Pillow 72.0/100: 72% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(22), conch_of_dark_whispers
0:43.596 default Q solar_wrath Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(21), conch_of_dark_whispers
0:44.517 default P lunar_strike Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(20), conch_of_dark_whispers
0:45.901 default J starsurge Fluffy_Pillow 54.5/100: 55% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(19), conch_of_dark_whispers
0:46.993 default O stellar_flare Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(18), conch_of_dark_whispers
0:48.058 default Q solar_wrath Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(16)
0:48.969 default P lunar_strike Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(16)
0:50.335 default J starsurge Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(14)
0:51.414 default M sunfire Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(13)
0:52.496 default Q solar_wrath Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(12)
0:53.420 default P lunar_strike Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(11)
0:54.811 default Q solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(10)
0:55.744 default P lunar_strike Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(9)
0:57.144 default Q solar_wrath Fluffy_Pillow 65.0/100: 65% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), overwhelming_power(7), conch_of_dark_whispers
0:58.085 default P lunar_strike Fluffy_Pillow 73.5/100: 74% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(6), conch_of_dark_whispers
0:59.499 default J starsurge Fluffy_Pillow 86.5/100: 87% astral_power arcanic_pulsar(5), solar_empowerment(2), overwhelming_power(5), conch_of_dark_whispers
1:00.716 default N moonfire Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord, overwhelming_power(4), conch_of_dark_whispers
1:01.903 default Q solar_wrath Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord, overwhelming_power(3), conch_of_dark_whispers
1:02.913 default P lunar_strike Fluffy_Pillow 63.5/100: 64% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord, overwhelming_power(2), conch_of_dark_whispers
1:04.432 default J starsurge Fluffy_Pillow 76.5/100: 77% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord, conch_of_dark_whispers
1:05.635 default Q solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(2), conch_of_dark_whispers
1:06.628 default P lunar_strike Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), conch_of_dark_whispers
1:08.117 default J starsurge Fluffy_Pillow 63.0/100: 63% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), conch_of_dark_whispers
1:09.286 default M sunfire Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3), conch_of_dark_whispers
1:10.423 default O stellar_flare Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3), conch_of_dark_whispers
1:11.559 default Q solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3)
1:12.528 default P lunar_strike Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3)
1:13.975 default P lunar_strike Fluffy_Pillow 58.0/100: 58% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3)
1:15.425 default Q solar_wrath Fluffy_Pillow 71.0/100: 71% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3)
1:16.392 default Q solar_wrath Fluffy_Pillow 83.5/100: 84% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3)
1:17.357 default I cancel_buff Fluffy_Pillow 92.5/100: 93% astral_power arcanic_pulsar(8), starlord(3)
1:17.357 default J starsurge Fluffy_Pillow 92.5/100: 93% astral_power arcanic_pulsar(8)
1:18.595 default Q solar_wrath Fluffy_Pillow 65.0/100: 65% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord
1:19.484 default J starsurge Fluffy_Pillow 73.5/100: 74% astral_power celestial_alignment, lunar_empowerment, starlord
1:20.529 default Q solar_wrath Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2)
1:21.393 default J starsurge Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2)
1:22.409 default Q solar_wrath Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3)
1:23.249 default L moonfire Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), starlord(3)
1:24.237 default P lunar_strike Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(2), lunar_empowerment(3), starlord(3)
1:25.684 default P lunar_strike Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(2), lunar_empowerment(2), starlord(3)
1:27.131 default J starsurge Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(2), lunar_empowerment, starlord(3)
1:28.267 default M sunfire Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment, starlord(3)
1:29.403 default P lunar_strike Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements
1:30.850 default P lunar_strike Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements
1:32.298 default J starsurge Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), torrent_of_elements
1:33.434 default O stellar_flare Fluffy_Pillow 1.0/100: 1% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements
1:34.570 default P lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements
1:36.018 default Q solar_wrath Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(4), solar_empowerment(3), starlord(3), torrent_of_elements
1:36.986 default Q solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), torrent_of_elements
1:37.953 default J starsurge Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(4), solar_empowerment, torrent_of_elements
1:39.192 default P lunar_strike Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord, torrent_of_elements
1:40.723 default Q solar_wrath Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord, torrent_of_elements
1:41.747 default Q solar_wrath Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(5), solar_empowerment, starlord, torrent_of_elements
1:42.769 default Q solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(5), starlord, torrent_of_elements
1:43.971 default J starsurge Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(5), starlord, torrent_of_elements
1:45.171 default M sunfire Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(2), torrent_of_elements
1:46.338 default N moonfire Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(2), torrent_of_elements
1:47.507 default P lunar_strike Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(2), torrent_of_elements
1:48.996 default Q solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(2), torrent_of_elements
1:49.990 default J starsurge Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(6), solar_empowerment, starlord(2), torrent_of_elements
1:51.159 default P lunar_strike Fluffy_Pillow 3.0/100: 3% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements
1:52.608 default Q solar_wrath Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), torrent_of_elements
1:53.574 default P lunar_strike Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(3)
1:55.021 default Q solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3)
1:55.985 default P lunar_strike Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(7), lunar_empowerment, starlord(3)
1:57.433 default O stellar_flare Fluffy_Pillow 59.0/100: 59% astral_power arcanic_pulsar(7), starlord(3)
1:58.570 default J starsurge Fluffy_Pillow 68.0/100: 68% astral_power arcanic_pulsar(7)
1:59.809 default P lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord
2:01.340 default J starsurge Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(8), solar_empowerment, starlord
2:02.544 default Q solar_wrath Fluffy_Pillow 14.5/100: 14% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2)
2:03.409 default P lunar_strike Fluffy_Pillow 23.0/100: 23% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2)
2:04.704 default G use_items Fluffy_Pillow 36.0/100: 36% astral_power celestial_alignment, solar_empowerment(2), starlord(2)
2:04.704 default Q solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power celestial_alignment, solar_empowerment(2), starlord(2), ignition_mages_fuse
2:05.529 default J starsurge Fluffy_Pillow 44.5/100: 45% astral_power celestial_alignment, solar_empowerment, starlord(2), ignition_mages_fuse
2:06.501 default Q solar_wrath Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), ignition_mages_fuse
2:07.304 default K sunfire Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), conch_of_dark_whispers, ignition_mages_fuse
2:08.251 default N moonfire Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord(3), conch_of_dark_whispers, ignition_mages_fuse
2:09.340 default P lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord(3), conch_of_dark_whispers, ignition_mages_fuse(2)
2:10.671 default Q solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar, solar_empowerment, starlord(3), conch_of_dark_whispers, ignition_mages_fuse(2)
2:11.561 default J starsurge Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar, starlord(3), conch_of_dark_whispers, ignition_mages_fuse(2)
2:12.607 default P lunar_strike Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(25), conch_of_dark_whispers, ignition_mages_fuse(2)
2:13.830 default Q solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), overwhelming_power(24), conch_of_dark_whispers, ignition_mages_fuse(3)
2:14.622 default Q solar_wrath Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(2), starlord(3), overwhelming_power(23), conch_of_dark_whispers, ignition_mages_fuse(3)
2:15.553 default Q solar_wrath Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(2), starlord(3), overwhelming_power(22), conch_of_dark_whispers, ignition_mages_fuse(3)
2:16.489 default Q solar_wrath Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(2), starlord(3), overwhelming_power(21), conch_of_dark_whispers, ignition_mages_fuse(3)
2:17.427 default P lunar_strike Fluffy_Pillow 54.5/100: 55% astral_power arcanic_pulsar(2), lunar_empowerment, starlord(3), overwhelming_power(20), conch_of_dark_whispers, ignition_mages_fuse(4)
2:18.583 default J starsurge Fluffy_Pillow 67.0/100: 67% astral_power arcanic_pulsar(2), overwhelming_power(19), conch_of_dark_whispers, ignition_mages_fuse(4)
2:19.574 default P lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(18), conch_of_dark_whispers, ignition_mages_fuse(4)
2:20.806 default J starsurge Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord, overwhelming_power(17), conch_of_dark_whispers, ignition_mages_fuse(5)
2:21.741 default M sunfire Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(2), overwhelming_power(16), conch_of_dark_whispers, ignition_mages_fuse(5)
2:22.653 default O stellar_flare Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(2), overwhelming_power(15), ignition_mages_fuse(5)
2:23.567 default Q solar_wrath Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(2), overwhelming_power(14), ignition_mages_fuse(5)
2:24.347 default P lunar_strike Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(13), ignition_mages_fuse(5)
2:25.520 default Q solar_wrath Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(2), overwhelming_power(12)
2:26.471 default J starsurge Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(11)
2:27.593 default P lunar_strike Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(10)
2:28.989 default N moonfire Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(9)
2:30.088 default P lunar_strike Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(7)
2:31.500 default J starsurge Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), overwhelming_power(6)
2:32.612 default Q solar_wrath Fluffy_Pillow 6.5/100: 7% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(5)
2:33.560 default P lunar_strike Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(4)
2:34.987 default Q solar_wrath Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), overwhelming_power(3)
2:35.943 default Q solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), overwhelming_power(2)
2:36.904 default P lunar_strike Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar(6), lunar_empowerment, starlord(3), overwhelming_power
2:38.345 default Q solar_wrath Fluffy_Pillow 62.5/100: 63% astral_power arcanic_pulsar(6), starlord(3)
2:39.482 default J starsurge Fluffy_Pillow 71.0/100: 71% astral_power arcanic_pulsar(6)
2:40.721 default M sunfire Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord
2:41.922 default P lunar_strike Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord
2:43.453 default J starsurge Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(7), solar_empowerment, starlord
2:44.655 default P lunar_strike Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2)
2:46.145 default O stellar_flare Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar(8), solar_empowerment(3), starlord(2)
2:47.312 default Q solar_wrath Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(8), solar_empowerment(3), starlord(2)
2:48.307 default J starsurge Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(2)
2:49.475 default Q solar_wrath Fluffy_Pillow 16.5/100: 17% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3)
2:50.315 default P lunar_strike Fluffy_Pillow 25.5/100: 26% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3)
2:51.573 default Q solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power celestial_alignment, solar_empowerment(2), starlord(3), overwhelming_power(24)
2:52.345 default J starsurge Fluffy_Pillow 46.5/100: 47% astral_power celestial_alignment, solar_empowerment, starlord(3), overwhelming_power(23)
2:53.256 default Q solar_wrath Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(22)
2:54.034 default P lunar_strike Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(24)
2:55.188 default N moonfire Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar, solar_empowerment, starlord(3), overwhelming_power(23)
2:56.233 default Q solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar, solar_empowerment, starlord(3), overwhelming_power(22)
2:57.125 default M sunfire Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar, starlord(3), overwhelming_power(21)
2:58.178 default Q solar_wrath Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar, starlord(3), overwhelming_power(20)
2:59.235 default Q solar_wrath Fluffy_Pillow 57.0/100: 57% astral_power arcanic_pulsar, starlord(3), overwhelming_power(19)
3:00.296 default J starsurge Fluffy_Pillow 66.0/100: 66% astral_power arcanic_pulsar, overwhelming_power(18)
3:01.455 default P lunar_strike Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(17)
3:02.895 default Q solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(2), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(16)
3:03.861 default H celestial_alignment Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(2), starlord, torrent_of_elements, overwhelming_power(15)
3:05.012 default E potion Fluffy_Pillow 89.0/100: 89% astral_power arcanic_pulsar(2), celestial_alignment, starlord, torrent_of_elements, overwhelming_power(13)
3:05.012 default F berserking Fluffy_Pillow 89.0/100: 89% astral_power arcanic_pulsar(2), celestial_alignment, starlord, torrent_of_elements, overwhelming_power(13), battle_potion_of_intellect
3:05.012 default J starsurge Fluffy_Pillow 89.0/100: 89% astral_power berserking, arcanic_pulsar(2), celestial_alignment, starlord, torrent_of_elements, overwhelming_power(13), battle_potion_of_intellect
3:05.920 default Q solar_wrath Fluffy_Pillow 49.5/100: 50% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(13), battle_potion_of_intellect
3:06.674 default J starsurge Fluffy_Pillow 58.0/100: 58% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(12), battle_potion_of_intellect
3:07.557 default Q solar_wrath Fluffy_Pillow 19.0/100: 19% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(11), battle_potion_of_intellect
3:08.312 default P lunar_strike Fluffy_Pillow 27.5/100: 28% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(10), battle_potion_of_intellect
3:09.415 default J starsurge Fluffy_Pillow 44.0/100: 44% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(9), battle_potion_of_intellect
3:10.285 default O stellar_flare Fluffy_Pillow 4.5/100: 5% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(8), conch_of_dark_whispers, battle_potion_of_intellect
3:11.159 default Q solar_wrath Fluffy_Pillow 13.0/100: 13% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(7), conch_of_dark_whispers, battle_potion_of_intellect
3:11.910 default P lunar_strike Fluffy_Pillow 21.5/100: 22% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(7), conch_of_dark_whispers, battle_potion_of_intellect
3:13.024 default N moonfire Fluffy_Pillow 34.5/100: 35% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(5), conch_of_dark_whispers, battle_potion_of_intellect
3:13.908 default Q solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(5), conch_of_dark_whispers, battle_potion_of_intellect
3:14.791 default J starsurge Fluffy_Pillow 46.5/100: 47% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(4), conch_of_dark_whispers, battle_potion_of_intellect
3:15.678 default M sunfire Fluffy_Pillow 7.0/100: 7% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(3), conch_of_dark_whispers, battle_potion_of_intellect
3:16.568 default Q solar_wrath Fluffy_Pillow 11.0/100: 11% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(2), conch_of_dark_whispers, battle_potion_of_intellect
3:17.326 default P lunar_strike Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power, conch_of_dark_whispers, battle_potion_of_intellect
3:18.579 default Q solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), conch_of_dark_whispers, battle_potion_of_intellect
3:19.420 default P lunar_strike Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), starlord(3), conch_of_dark_whispers, battle_potion_of_intellect
3:20.679 default J starsurge Fluffy_Pillow 57.5/100: 57% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment, conch_of_dark_whispers, battle_potion_of_intellect
3:21.757 default Q solar_wrath Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, conch_of_dark_whispers, battle_potion_of_intellect
3:22.648 default P lunar_strike Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), starlord, conch_of_dark_whispers, battle_potion_of_intellect
3:23.978 default J starsurge Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment, starlord, conch_of_dark_whispers, battle_potion_of_intellect
3:25.026 default P lunar_strike Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment, starlord(2), battle_potion_of_intellect
3:26.514 default P lunar_strike Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(2), battle_potion_of_intellect
3:28.004 default Q solar_wrath Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(2), battle_potion_of_intellect
3:28.996 default J starsurge Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(8), solar_empowerment, starlord(2), battle_potion_of_intellect
3:30.166 default Q solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3)
3:31.009 default P lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3)
3:32.267 default J starsurge Fluffy_Pillow 41.5/100: 42% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3)
3:33.255 default O stellar_flare Fluffy_Pillow 2.0/100: 2% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3)
3:34.245 default Q solar_wrath Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3)
3:35.087 default K sunfire Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3)
3:36.075 default N moonfire Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord(3)
3:37.212 default P lunar_strike Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord(3)
3:38.659 default P lunar_strike Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord(3)
3:40.106 default Q solar_wrath Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar, solar_empowerment, starlord(3)
3:41.073 default J starsurge Fluffy_Pillow 65.0/100: 65% astral_power arcanic_pulsar
3:42.313 default P lunar_strike Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord
3:43.843 default Q solar_wrath Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(2), solar_empowerment, starlord
3:44.867 default J starsurge Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(2), starlord
3:46.070 default P lunar_strike Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord(2)
3:47.559 default Q solar_wrath Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(3), solar_empowerment, starlord(2)
3:48.553 default Q solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(3), starlord(2), overwhelming_power(25)
3:49.621 default J starsurge Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(3), starlord(2), torrent_of_elements, overwhelming_power(24)
3:50.693 default P lunar_strike Fluffy_Pillow 3.5/100: 4% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(23)
3:52.024 default M sunfire Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar(4), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(21)
3:53.077 default Q solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(4), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(20)
3:53.976 default Q solar_wrath Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(4), starlord(3), torrent_of_elements, overwhelming_power(20)
3:55.034 default Q solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(4), starlord(3), torrent_of_elements, overwhelming_power(18)
3:56.098 default P lunar_strike Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(4), lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(17)
3:57.457 default N moonfire Fluffy_Pillow 59.0/100: 59% astral_power arcanic_pulsar(4), starlord(3), torrent_of_elements, overwhelming_power(16)
3:58.530 default O stellar_flare Fluffy_Pillow 63.0/100: 63% astral_power arcanic_pulsar(4), starlord(3), torrent_of_elements, overwhelming_power(15)
3:59.605 default Q solar_wrath Fluffy_Pillow 71.5/100: 72% astral_power arcanic_pulsar(4), starlord(3), torrent_of_elements, overwhelming_power(14)
4:00.683 default P lunar_strike Fluffy_Pillow 80.0/100: 80% astral_power arcanic_pulsar(4), lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(13)
4:02.062 default J starsurge Fluffy_Pillow 93.0/100: 93% astral_power arcanic_pulsar(4), torrent_of_elements, overwhelming_power(11), conch_of_dark_whispers
4:03.254 default J starsurge Fluffy_Pillow 54.0/100: 54% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(10), conch_of_dark_whispers
4:04.413 default P lunar_strike Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(9), conch_of_dark_whispers
4:05.852 default G use_items Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(2), overwhelming_power(8), conch_of_dark_whispers
4:05.852 default Q solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(2), overwhelming_power(8), conch_of_dark_whispers, ignition_mages_fuse
4:06.775 default P lunar_strike Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(7), conch_of_dark_whispers, ignition_mages_fuse
4:08.167 default Q solar_wrath Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar(6), solar_empowerment(3), starlord(2), overwhelming_power(5), conch_of_dark_whispers, ignition_mages_fuse
4:09.101 default J starsurge Fluffy_Pillow 58.0/100: 58% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(2), overwhelming_power(4), conch_of_dark_whispers, ignition_mages_fuse
4:10.204 default M sunfire Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(3), conch_of_dark_whispers, ignition_mages_fuse(2)
4:11.237 default Q solar_wrath Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(2), conch_of_dark_whispers, ignition_mages_fuse(2)
4:12.120 default P lunar_strike Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power, conch_of_dark_whispers, ignition_mages_fuse(2)
4:13.445 default Q solar_wrath Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(7), solar_empowerment(3), starlord(3), conch_of_dark_whispers, ignition_mages_fuse(2)
4:14.331 default J starsurge Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers, ignition_mages_fuse(3)
4:15.335 default Q solar_wrath Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3), conch_of_dark_whispers, ignition_mages_fuse(3)
4:16.189 default P lunar_strike Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(24), conch_of_dark_whispers, ignition_mages_fuse(3)
4:17.373 default P lunar_strike Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(23), ignition_mages_fuse(3)
4:18.561 default Q solar_wrath Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), overwhelming_power(22), ignition_mages_fuse(4)
4:19.329 default N moonfire Fluffy_Pillow 55.5/100: 56% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(21), ignition_mages_fuse(4)
4:20.233 default Q solar_wrath Fluffy_Pillow 63.0/100: 63% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(20), ignition_mages_fuse(4)
4:21.006 default O stellar_flare Fluffy_Pillow 72.0/100: 72% astral_power arcanic_pulsar(8), lunar_empowerment, starlord(3), overwhelming_power(19), ignition_mages_fuse(4)
4:21.920 default P lunar_strike Fluffy_Pillow 80.5/100: 81% astral_power arcanic_pulsar(8), lunar_empowerment, starlord(3), overwhelming_power(19), ignition_mages_fuse(5)
4:23.038 default J starsurge Fluffy_Pillow 93.0/100: 93% astral_power arcanic_pulsar(8), overwhelming_power(17), ignition_mages_fuse(5)
4:24.002 default Q solar_wrath Fluffy_Pillow 66.0/100: 66% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(16), ignition_mages_fuse(5)
4:24.756 default J starsurge Fluffy_Pillow 74.5/100: 75% astral_power celestial_alignment, lunar_empowerment, starlord, overwhelming_power(16), ignition_mages_fuse(5)
4:25.573 default Q solar_wrath Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(15), ignition_mages_fuse(5)
4:26.327 default J starsurge Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), overwhelming_power(14)
4:27.293 default Q solar_wrath Fluffy_Pillow 4.0/100: 4% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(13)
4:28.094 default P lunar_strike Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(12)
4:29.299 default K sunfire Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(11)
4:30.249 default P lunar_strike Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(2), lunar_empowerment(2), starlord(3), overwhelming_power(10)
4:31.645 default J starsurge Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(9)
4:32.745 default P lunar_strike Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(8)
4:34.150 default P lunar_strike Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(6)
4:35.565 default Q solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), overwhelming_power(5)
4:36.513 default J starsurge Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), overwhelming_power(4)
4:37.634 default P lunar_strike Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(3)
4:39.066 default Q solar_wrath Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), overwhelming_power
4:40.030 default Q solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar(4), solar_empowerment, starlord(3)
4:40.995 default Q solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(4), starlord(3)
4:42.134 default J starsurge Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(4), lunar_empowerment, starlord(3)
4:43.270 default P lunar_strike Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 16238 14762 13761
Intellect 1467 -3 13346 11714 9693 (6045)
Spirit 0 0 0 0 0
Health 324760 295240 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 13346 11714 0
Crit 15.68% 15.68% 769
Haste 21.51% 21.51% 1463
Damage / Heal Versatility 4.81% 4.81% 409
ManaReg per Second 2378 640 0
Attack Power 13880 12183 0
Mastery 55.20% 55.20% 2005
Armor 2962 2962 2962
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 447.00
Local Head Hood of the Slithering Loa
ilevel: 450, stats: { 407 Armor, +1145 AgiInt, +2255 Sta }
Local Neck Heart of Azeroth
ilevel: 463, stats: { +325 Haste, +325 Crit, +325 Mastery, +719 Sta, +382 StrAgiInt }
Local Shoulders Gorak Tul's Mantle
ilevel: 450, stats: { 376 Armor, +859 AgiInt, +1691 Sta }
Local Chest Spymaster's Wrap
ilevel: 450, stats: { 501 Armor, +1145 AgiInt, +2255 Sta }
Local Waist Beloved Monarch's Waistwrap
ilevel: 445, stats: { 271 Armor, +431 AgiInt, +789 Sta, +147 Mastery, +82 Crit }
Local Legs Leggings of the Stormborn
ilevel: 445, stats: { 422 Armor, +575 AgiInt, +1053 Sta, +179 Vers, +126 Crit }
Local Feet Ancient Tempest Striders
ilevel: 445, stats: { 331 Armor, +431 AgiInt, +789 Sta, +134 Mastery, +95 Haste }
Local Wrists Tideblood Bracers
ilevel: 445, stats: { 211 Armor, +323 AgiInt, +592 Sta, +105 Haste, +66 Crit }
Local Hands Gloves of Incomparable Beauty
ilevel: 445, stats: { 301 Armor, +431 AgiInt, +789 Sta, +134 Haste, +95 Mastery }
Local Finger1 Boralus Noble's Seal
ilevel: 445, stats: { +592 Sta, +369 Mastery, +169 Haste }, enchant: { +60 Haste }
Local Finger2 Cursed Lover's Ring
ilevel: 445, stats: { +592 Sta, +307 Haste, +230 Vers }, enchant: { +60 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 445, stats: { +546 Int }
Local Trinket2 Conch of Dark Whispers
ilevel: 445, stats: { +546 Int }
Local Back Cloak of Ill Tidings
ilevel: 445, stats: { 142 Armor, +323 StrAgiInt, +592 Sta, +110 Mastery, +61 Crit }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 445, weapon: { 661 - 896, 3.6 }, stats: { +575 Int, +1053 Sta, +109 Haste, +109 Crit, +109 Mastery, +1981 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="base"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
talents=1000231
azerite_override=lifespeed:450/heed_my_call:450/overwhelming_power:450/streaking_stars:450/streaking_stars:450/streaking_stars:450/arcanic_pulsar:450/loyal_to_the_end:450/loyal_to_the_end:450

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6&active_enemies=1
actions+=/potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
actions+=/blood_fury,if=buff.ca_inc.up
actions+=/berserking,if=buff.ca_inc.up
actions+=/arcane_torrent,if=buff.ca_inc.up
actions+=/lights_judgment,if=buff.ca_inc.up
actions+=/fireblood,if=buff.ca_inc.up
actions+=/ancestral_call,if=buff.ca_inc.up
actions+=/use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
actions+=/use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
actions+=/use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
actions+=/celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=hood_of_the_slithering_loa,id=159318,ilevel=450
neck=heart_of_azeroth,id=158075,ilevel=463
shoulders=gorak_tuls_mantle,id=159339,ilevel=450
back=cloak_of_ill_tidings,id=168391,ilevel=445
chest=spymasters_wrap,id=155860,ilevel=450
wrists=tideblood_bracers,id=168377,ilevel=445
hands=gloves_of_incomparable_beauty,id=168887,ilevel=445
waist=beloved_monarchs_waistwrap,id=168871,ilevel=445
legs=leggings_of_the_stormborn,id=168378,ilevel=445
feet=ancient_tempest_striders,id=168380,ilevel=445
finger1=boralus_nobles_seal,id=168889,ilevel=445,enchant=60haste
finger2=cursed_lovers_ring,id=168891,ilevel=445,enchant=60haste
trinket1=ignition_mages_fuse,id=159615,ilevel=445
trinket2=conch_of_dark_whispers,id=159620,ilevel=445
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=445,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=447.20
# gear_stamina=13761
# gear_intellect=9693
# gear_crit_rating=769
# gear_haste_rating=1364
# gear_mastery_rating=1289
# gear_versatility_rating=409
# gear_armor=2962

blood of the enemy : 42778 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
42778.4 42778.4 22.6 / 0.053% 5555.0 / 13.0% 5163.5
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.3 8.1 Astral Power 0.00% 59.0 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Stellar Flare (Balance Druid)
  • 100: Shooting Stars (Balance Druid)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
blood of the enemy 42778
Blood of the Enemy 441 1.0% 3.7 91.13sec 35926 37607 Direct 3.7 27666 69199 35926 19.9%  

Stats details: blood_of_the_enemy

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.68 3.68 0.00 0.00 0.9555 0.0000 132075.77 132075.77 0.00 37606.99 37606.99
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2.95 80.11% 27666.21 27139 29853 27563.16 0 29853 81481 81481 0.00
crit 0.73 19.89% 69198.55 67847 74632 38432.71 0 74632 50595 50595 0.00
 
 

Action details: blood_of_the_enemy

Static Values
  • id:297108
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:cooldown.ca_inc.remains>30
Spelldata
  • id:297108
  • name:Blood of the Enemy
  • school:shadow
  • tooltip:You have a $w2% increased chance to be Critically Hit by the caster.
  • description:The Heart of Azeroth erupts violently, dealing {$s1=5936} Shadow damage to enemies within $A1 yds. You gain $m2% critical strike chance against the targets for {$d=10 seconds}$?a297122[, and increases your critical hit damage by $297126m% for {$297126d=5 seconds}][].
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:24659.81
  • base_dd_max:24659.81
  • base_dd_mult:1.00
 
Heed My Call 317 (453) 0.7% (1.1%) 8.4 32.58sec 16231 0 Direct 8.4 9128 18766 11365 23.2%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.36 8.36 0.00 0.00 0.0000 0.0000 94957.67 94957.67 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.42 76.78% 9127.56 8921 9813 9122.32 0 9813 58557 58557 0.00
crit 1.94 23.22% 18765.75 17842 24532 16185.45 0 24532 36400 36400 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 136 0.3% 8.4 32.58sec 4866 0 Direct 8.4 3912 8027 4866 23.2%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.36 8.36 0.00 0.00 0.0000 0.0000 40658.78 40658.78 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.42 76.82% 3912.37 3823 4206 3911.82 0 4206 25110 25110 0.00
crit 1.94 23.18% 8027.21 7646 10514 6955.75 0 10514 15549 15549 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 6110 14.3% 78.0 3.74sec 23438 18222 Direct 78.0 18962 38940 23438 22.4%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 78.01 78.01 0.00 0.00 1.2862 0.0000 1828440.40 1828440.40 0.00 18222.08 18222.08
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 60.54 77.60% 18962.30 10135 24211 18969.04 18279 20118 1147897 1147897 0.00
crit 17.48 22.40% 38939.60 20270 60528 38977.18 35052 45495 680543 680543 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 3047 7.1% 14.0 21.44sec 64900 65056 Direct 14.0 3274 6799 4066 22.5%  
Periodic 226.1 3009 6321 3778 23.2% 99.3%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.04 14.04 226.09 226.09 0.9977 1.3156 911305.96 911305.96 0.00 2925.98 65056.11
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.89 77.55% 3274.44 2981 4065 3275.63 3007 3614 35656 35656 0.00
crit 3.15 22.45% 6798.59 5963 10163 6625.51 0 10163 21433 21433 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 173.6 76.78% 3009.04 2 3785 3010.27 2919 3166 522322 522322 0.00
crit 52.5 23.22% 6321.36 21 9462 6326.88 5868 6920 331895 331895 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Shooting Stars 980 2.3% 45.2 6.47sec 6493 0 Direct 45.2 5172 10851 6493 23.3%  

Stats details: shooting_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.15 45.15 0.00 0.00 0.0000 0.0000 293193.37 293193.37 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 34.65 76.74% 5172.33 4769 6503 5174.27 4858 5654 179237 179237 0.00
crit 10.50 23.26% 10851.11 9539 16257 10859.46 0 14779 113956 113956 0.00
 
 

Action details: shooting_stars

Static Values
  • id:202497
  • school:astral
  • resource:none
  • range:50000.0
  • travel_speed:0.8000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating ${$202497m2/10} Astral Power.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.360000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Solar Wrath 3434 (5482) 8.0% (12.8%) 95.0 3.10sec 17269 19355 Direct 95.5 8642 17824 10759 23.1%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 94.98 95.49 0.00 0.00 0.8922 0.0000 1027356.36 1027356.36 0.00 19355.48 19355.48
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.47 76.94% 8641.58 7949 10838 8645.94 8350 9073 634912 634912 0.00
crit 22.02 23.06% 17823.95 15898 27096 17842.82 16119 20300 392444 392444 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (solar_empowerment) 2048 4.8% 75.1 3.89sec 8155 0 Direct 75.1 8155 0 8155 0.0%  

Stats details: solar_empowerment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 75.14 75.14 0.00 0.00 0.0000 0.0000 612768.53 612768.53 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.14 100.00% 8154.56 5962 20322 8161.83 7072 9854 612769 612769 0.00
 
 

Action details: solar_empowerment

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:5961.69
  • base_dd_max:5961.69
  • base_dd_mult:1.00
 
Starsurge 14499 33.9% 61.9 4.88sec 70039 67662 Direct 61.7 55692 117665 70268 23.5%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 61.90 61.70 0.00 0.00 1.0351 0.0000 4335664.61 4335664.61 0.00 67662.30 67662.30
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 47.19 76.48% 55692.45 51347 69612 55711.63 53229 58706 2628085 2628085 0.00
crit 14.51 23.52% 117665.09 102695 174029 117852.28 102695 144854 1707579 1707579 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Stellar Flare 1983 4.6% 12.8 23.57sec 46383 45828 Direct 12.8 2776 5897 3479 22.5%  
Periodic 223.8 1950 4099 2451 23.3% 98.4%

Stats details: stellar_flare

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.79 12.79 223.82 223.82 1.0121 1.3176 593060.05 593060.05 0.00 1926.50 45827.99
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.91 77.47% 2775.51 2570 3504 2775.21 2570 3087 27494 27494 0.00
crit 2.88 22.53% 5896.62 5140 8761 5701.27 0 8761 16984 16984 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 171.7 76.70% 1950.38 6 2453 1951.17 1897 2044 334832 334832 0.00
crit 52.1 23.30% 4099.21 7 6133 4103.12 3792 4601 213750 213750 0.00
 
 

Action details: stellar_flare

Static Values
  • id:202347
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
Spelldata
  • id:202347
  • name:Stellar Flare
  • school:astral
  • tooltip:Suffering $w2 Astral damage every $t2 sec.
  • description:Burns the target for {$s1=0} Astral damage, and then an additional $o2 damage over {$d=24 seconds}. |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.125000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.087500
  • base_td:0.00
  • base_td_mult:0.82
  • dot_duration:24.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Streaking Star (s) 6401 14.9% 89.9 3.10sec 21189 0 Direct 89.9 16393 34156 21190 27.0%  

Stats details: streaking_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 89.88 89.88 0.00 0.00 0.0000 0.0000 1904413.70 1904413.70 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 65.61 73.00% 16392.93 16021 17623 16392.93 16021 17234 1075510 1075510 0.00
crit 24.27 27.00% 34156.38 32042 44057 34169.28 32042 39037 828903 828903 0.00
 
 

Action details: streaking_stars

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 3382 7.9% 17.8 16.79sec 56756 56216 Direct 17.8 4487 9280 5555 22.3%  
Periodic 225.2 3233 6776 4053 23.1% 99.0%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.83 17.83 225.23 225.23 1.0096 1.3167 1011776.54 1011776.54 0.00 3216.50 56216.05
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.85 77.71% 4486.54 4112 5607 4486.77 4147 4904 62156 62156 0.00
crit 3.97 22.29% 9280.34 8225 14018 9189.62 0 14018 36870 36870 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 173.1 76.86% 3232.59 2 4065 3233.89 3136 3399 559611 559611 0.00
crit 52.1 23.14% 6776.12 9 10163 6782.31 6190 7434 353140 353140 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Simple Action Stats Execute Interval
blood of the enemy
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:blood of the enemy
  • harmful:false
  • if_expr:
 
Berserking 2.0 182.67sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.0 182.55sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.8983 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:251837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:blood of the enemy
  • harmful:false
  • if_expr:
 
Bountiful Captain's Feast (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:259410
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:blood of the enemy
  • harmful:false
  • if_expr:
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Battle Potion of Intellect (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:279151
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 7.3 54.4 43.8sec 4.9sec 93.25% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:11.85%
  • arcanic_pulsar_2:10.28%
  • arcanic_pulsar_3:11.56%
  • arcanic_pulsar_4:10.87%
  • arcanic_pulsar_5:13.51%
  • arcanic_pulsar_6:10.55%
  • arcanic_pulsar_7:10.67%
  • arcanic_pulsar_8:13.97%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 187.6sec 0.0sec 16.24% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.24%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Battle-Scarred Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Berserking 2.0 0.0 182.7sec 182.7sec 8.12% 7.74% 0.0(0.0) 2.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Blood-Soaked 5.5 0.0 54.8sec 54.8sec 14.49% 0.00% 0.0(0.0) 5.4

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_bloodsoaked
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:631.87

Stack Uptimes

  • bloodsoaked_1:14.49%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:297168
  • name:Blood-Soaked
  • tooltip:Haste increased by $w1. While active Blood of the Enemy stacks are not granted.
  • description:{$@spelldesc297147=Your critical strikes with spells and abilities grant a stack of Blood-Soaked$?a297177[, increasing Critical Strike by {$297147s3=0}][]. Upon reaching {$297162u=40} stacks, you gain {$s2=0} Haste for {$297168d=8 seconds}.$?a297178[ Blood-Soaked has a {$297178s1=25}% chance of only consuming {$297178s2=30} stacks.][]}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Blood-Soaked (_counter) 5.0 218.2 63.1sec 1.3sec 86.66% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_bloodsoaked_counter
  • max_stacks:40
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:crit_rating
  • amount:9.69

Stack Uptimes

  • bloodsoaked_counter_1:2.50%
  • bloodsoaked_counter_2:2.29%
  • bloodsoaked_counter_3:2.11%
  • bloodsoaked_counter_4:2.02%
  • bloodsoaked_counter_5:1.98%
  • bloodsoaked_counter_6:1.94%
  • bloodsoaked_counter_7:1.90%
  • bloodsoaked_counter_8:1.89%
  • bloodsoaked_counter_9:1.86%
  • bloodsoaked_counter_10:6.06%
  • bloodsoaked_counter_11:2.44%
  • bloodsoaked_counter_12:2.44%
  • bloodsoaked_counter_13:2.41%
  • bloodsoaked_counter_14:2.38%
  • bloodsoaked_counter_15:2.35%
  • bloodsoaked_counter_16:2.33%
  • bloodsoaked_counter_17:2.29%
  • bloodsoaked_counter_18:2.27%
  • bloodsoaked_counter_19:2.25%
  • bloodsoaked_counter_20:2.22%
  • bloodsoaked_counter_21:2.20%
  • bloodsoaked_counter_22:2.18%
  • bloodsoaked_counter_23:2.15%
  • bloodsoaked_counter_24:2.13%
  • bloodsoaked_counter_25:2.12%
  • bloodsoaked_counter_26:2.10%
  • bloodsoaked_counter_27:2.09%
  • bloodsoaked_counter_28:2.06%
  • bloodsoaked_counter_29:2.05%
  • bloodsoaked_counter_30:2.05%
  • bloodsoaked_counter_31:2.01%
  • bloodsoaked_counter_32:2.02%
  • bloodsoaked_counter_33:1.98%
  • bloodsoaked_counter_34:1.97%
  • bloodsoaked_counter_35:1.95%
  • bloodsoaked_counter_36:1.93%
  • bloodsoaked_counter_37:1.93%
  • bloodsoaked_counter_38:1.91%
  • bloodsoaked_counter_39:1.88%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:297162
  • name:Blood-Soaked
  • tooltip:$?a297177[Critical strike increased by $w2. ][]$@spellaura297147
  • description:{$@spelldesc297147=Your critical strikes with spells and abilities grant a stack of Blood-Soaked$?a297177[, increasing Critical Strike by {$297147s3=0}][]. Upon reaching {$297162u=40} stacks, you gain {$s2=0} Haste for {$297168d=8 seconds}.$?a297178[ Blood-Soaked has a {$297178s1=25}% chance of only consuming {$297178s2=30} stacks.][]}
  • max_stacks:40
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (bountiful_captains_feast) 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Celestial Alignment 8.3 0.0 37.4sec 37.4sec 26.07% 32.53% 0.0(0.0) 8.1

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:26.07%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Conch of Dark Whispers 4.3 1.2 61.0sec 45.5sec 23.70% 0.00% 1.2(1.2) 4.1

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_conch_of_dark_whispers
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Conch of Dark Whispers

Stat Buff details

  • stat:crit_rating
  • amount:913.59

Stack Uptimes

  • conch_of_dark_whispers_1:23.70%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271071
  • name:Conch of Dark Whispers
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc271072=Your spells have a chance to grant you {$271071s1=649} Critical Strike for {$271071d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Ignition Mage's Fuse 3.0 0.0 120.3sec 120.3sec 19.24% 0.00% 2.8(2.8) 2.8

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:366.08

Stack Uptimes

  • ignition_mages_fuse_1:3.95%
  • ignition_mages_fuse_2:3.90%
  • ignition_mages_fuse_3:3.85%
  • ignition_mages_fuse_4:3.79%
  • ignition_mages_fuse_5:3.74%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lunar Empowerment 34.4 46.7 8.8sec 3.7sec 82.13% 99.79% 1.9(1.9) 0.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:35.83%
  • lunar_empowerment_2:32.02%
  • lunar_empowerment_3:14.27%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Moonkin Form 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Nature's Balance 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 399.0(399.0) 0.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_natures_balance
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.75

Stack Uptimes

  • natures_balance_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202430
  • name:Nature's Balance
  • tooltip:Grants $m3 Astral Power every $m4 sec while in combat or while below 50 Astral Power.
  • description:While in combat you generate $m3 Astral Power every $m4 sec. While out of combat your Astral Power rebalances to 50 instead of depleting to empty.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Overwhelming Power 4.6 3.6 64.1sec 33.4sec 48.47% 0.00% 3.6(49.8) 0.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.38%
  • overwhelming_power_2:1.42%
  • overwhelming_power_3:1.46%
  • overwhelming_power_4:1.50%
  • overwhelming_power_5:1.54%
  • overwhelming_power_6:1.59%
  • overwhelming_power_7:1.63%
  • overwhelming_power_8:1.68%
  • overwhelming_power_9:1.73%
  • overwhelming_power_10:1.78%
  • overwhelming_power_11:1.83%
  • overwhelming_power_12:1.89%
  • overwhelming_power_13:1.94%
  • overwhelming_power_14:2.00%
  • overwhelming_power_15:2.06%
  • overwhelming_power_16:2.13%
  • overwhelming_power_17:2.19%
  • overwhelming_power_18:2.26%
  • overwhelming_power_19:2.32%
  • overwhelming_power_20:2.40%
  • overwhelming_power_21:2.47%
  • overwhelming_power_22:2.55%
  • overwhelming_power_23:2.63%
  • overwhelming_power_24:2.70%
  • overwhelming_power_25:1.37%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Seething Rage 3.7 0.0 91.1sec 91.1sec 6.10% 0.00% 0.0(0.0) 3.6

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_seething_rage
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • seething_rage_1:6.10%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:297126
  • name:Seething Rage
  • tooltip:Critical strike damage increased by $w1%.
  • description:{$@spelldesc297122=Increases your critical hit damage by $297126m% for {$297126d=5 seconds}.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Solar Empowerment 24.7 52.8 12.0sec 3.9sec 85.91% 78.81% 0.3(0.3) 0.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:28.21%
  • solar_empowerment_2:39.96%
  • solar_empowerment_3:17.73%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starlord 15.3 46.6 20.2sec 4.9sec 97.82% 93.08% 16.4(16.4) 11.4

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:14.41%
  • starlord_2:22.47%
  • starlord_3:60.94%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.3 1.1 61.0sec 45.7sec 23.65% 0.00% 1.1(1.1) 4.1

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.65%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
blood of the enemy
starsurge Astral Power 61.9 2476.2 40.0 40.0 1751.0
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 95.98 767.76 (31.48%) 8.00 0.06 0.01%
celestial_alignment Astral Power 2.00 80.00 (3.28%) 40.00 0.00 0.00%
sunfire Astral Power 17.83 53.48 (2.19%) 3.00 0.00 0.00%
shooting_stars Astral Power 45.15 180.61 (7.41%) 4.00 0.01 0.01%
moonfire Astral Power 14.04 42.12 (1.73%) 3.00 0.00 0.00%
stellar_flare Astral Power 12.79 102.29 (4.19%) 8.00 0.00 0.00%
lunar_strike Astral Power 78.01 936.09 (38.38%) 12.00 0.06 0.01%
natures_balance Astral Power 400.01 200.00 (8.20%) 0.50 0.00 0.00%
arcanic_pulsar Astral Power 6.37 76.47 (3.14%) 12.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 8.14 8.26
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 19.81 0.00 66.00
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data blood of the enemy Fight Length
Count 15384
Mean 299.63
Minimum 240.01
Maximum 359.99
Spread ( max - min ) 119.97
Range [ ( max - min ) / 2 * 100% ] 20.02%
DPS
Sample Data blood of the enemy Damage Per Second
Count 15384
Mean 42778.45
Minimum 38409.25
Maximum 48717.51
Spread ( max - min ) 10308.25
Range [ ( max - min ) / 2 * 100% ] 12.05%
Standard Deviation 1428.8410
5th Percentile 40524.18
95th Percentile 45236.45
( 95th Percentile - 5th Percentile ) 4712.27
Mean Distribution
Standard Deviation 11.5199
95.00% Confidence Intervall ( 42755.87 - 42801.03 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 43
0.1% Error 4286
0.1 Scale Factor Error with Delta=300 17429
0.05 Scale Factor Error with Delta=300 69713
0.01 Scale Factor Error with Delta=300 1742816
Priority Target DPS
Sample Data blood of the enemy Priority Target Damage Per Second
Count 15384
Mean 42778.45
Minimum 38409.25
Maximum 48717.51
Spread ( max - min ) 10308.25
Range [ ( max - min ) / 2 * 100% ] 12.05%
Standard Deviation 1428.8410
5th Percentile 40524.18
95th Percentile 45236.45
( 95th Percentile - 5th Percentile ) 4712.27
Mean Distribution
Standard Deviation 11.5199
95.00% Confidence Intervall ( 42755.87 - 42801.03 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 43
0.1% Error 4286
0.1 Scale Factor Error with Delta=300 17429
0.05 Scale Factor Error with Delta=300 69713
0.01 Scale Factor Error with Delta=300 1742816
DPS(e)
Sample Data blood of the enemy Damage Per Second (Effective)
Count 15384
Mean 42778.45
Minimum 38409.25
Maximum 48717.51
Spread ( max - min ) 10308.25
Range [ ( max - min ) / 2 * 100% ] 12.05%
Damage
Sample Data blood of the enemy Damage
Count 15384
Mean 12785671.73
Minimum 9971920.45
Maximum 15725470.63
Spread ( max - min ) 5753550.17
Range [ ( max - min ) / 2 * 100% ] 22.50%
DTPS
Sample Data blood of the enemy Damage Taken Per Second
Count 15384
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data blood of the enemy Healing Per Second
Count 15384
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data blood of the enemy Healing Per Second (Effective)
Count 15384
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data blood of the enemy Heal
Count 15384
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data blood of the enemy Healing Taken Per Second
Count 15384
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data blood of the enemy Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data blood of the enemyTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data blood of the enemy Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
E 1.00 potion,if=buff.ca_inc.remains>6&active_enemies=1
0.00 potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
0.00 blood_fury,if=buff.ca_inc.up
F 2.00 berserking,if=buff.ca_inc.up
0.00 arcane_torrent,if=buff.ca_inc.up
0.00 lights_judgment,if=buff.ca_inc.up
0.00 fireblood,if=buff.ca_inc.up
0.00 ancestral_call,if=buff.ca_inc.up
0.00 use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
0.00 use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
0.00 use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
0.00 use_item,name=tidestorm_codex,if=equipped.165576
G 2.95 use_items,if=cooldown.ca_inc.remains>30
H 3.68 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams
0.00 purifying_blast
0.00 ripple_in_space
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
I 2.00 celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
0.00 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
J 2.96 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
0.00 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
K 61.90 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
L 2.79 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
M 3.09 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
N 14.76 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
O 10.96 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
P 12.79 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
Q 78.37 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
R 95.23 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
S 0.28 sunfire

Sample Sequence

0123456789ACDKONPIFGHKRQKRQKRQRKRQNRORQRQKPKRLQKQQQRRRRKRKRQRQRMJKKNQQKPRQQKRQRQRRRKKNOQQRKPRQQRRRNRJKRKRQKMQRQRKPHNRQQKRKROQKRQQKNRQPQRRKQKGRQKRQMQKNQRRRQRRPKKQQRKRONQRKRQRQRQKKPRQKNRQKRMQRQRRQKIEFHKNRKPRQKRORQKRQRQRQKKNQQRRKRPKRQMQRRRNKQKRQRKQRRRKOPQNRRKQGRRKQRRRKQRRRNORPRRJKRKRKRQLQKQHQRRRRKQ

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask blood of the enemy 58.0/100: 58% astral_power
Pre precombat 1 food blood of the enemy 58.0/100: 58% astral_power
Pre precombat 2 augmentation blood of the enemy 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 9 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power battle_potion_of_intellect
0:00.000 default K starsurge Fluffy_Pillow 66.0/100: 66% astral_power lunar_empowerment, battle_potion_of_intellect
0:01.239 default O moonfire Fluffy_Pillow 26.5/100: 27% astral_power bloodlust, arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord, battle_potion_of_intellect
0:02.165 default N sunfire Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(24), battle_potion_of_intellect
0:03.014 default P stellar_flare Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(23), bloodsoaked_counter, battle_potion_of_intellect
0:03.868 default I celestial_alignment Fluffy_Pillow 42.5/100: 43% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(23), bloodsoaked_counter(2), conch_of_dark_whispers, battle_potion_of_intellect
0:04.622 default F berserking Fluffy_Pillow 83.0/100: 83% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(22), bloodsoaked_counter(3), conch_of_dark_whispers, battle_potion_of_intellect
0:04.622 default G use_items Fluffy_Pillow 83.0/100: 83% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(22), bloodsoaked_counter(3), conch_of_dark_whispers, battle_potion_of_intellect
0:04.622 default H blood_of_the_enemy Fluffy_Pillow 83.0/100: 83% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(22), bloodsoaked_counter(3), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse
0:05.376 default K starsurge Fluffy_Pillow 83.5/100: 84% astral_power bloodlust, berserking, seething_rage, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(21), bloodsoaked_counter(4), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse
0:06.130 default R solar_wrath Fluffy_Pillow 44.0/100: 44% astral_power bloodlust, berserking, seething_rage, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(20), bloodsoaked_counter(7), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse
0:06.882 default Q lunar_strike Fluffy_Pillow 52.5/100: 53% astral_power bloodlust, berserking, seething_rage, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(20), bloodsoaked_counter(9), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse
0:07.691 default K starsurge Fluffy_Pillow 65.0/100: 65% astral_power bloodlust, berserking, seething_rage, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(19), bloodsoaked_counter(12), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse
0:08.447 default R solar_wrath Fluffy_Pillow 25.5/100: 26% astral_power bloodlust, berserking, seething_rage, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(18), bloodsoaked_counter(16), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse
0:09.201 default Q lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, berserking, seething_rage, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(17), bloodsoaked_counter(19), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(2)
0:09.967 default K starsurge Fluffy_Pillow 50.5/100: 51% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(17), bloodsoaked_counter(23), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(2)
0:10.723 default R solar_wrath Fluffy_Pillow 15.0/100: 15% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(16), bloodsoaked_counter(27), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.479 default Q lunar_strike Fluffy_Pillow 23.5/100: 24% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(15), bloodsoaked_counter(30), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.251 default R solar_wrath Fluffy_Pillow 40.0/100: 40% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(14), bloodsoaked_counter(35), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.005 default K starsurge Fluffy_Pillow 48.5/100: 49% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(13), bloodsoaked_counter(38), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(3)
0:13.759 default R solar_wrath Fluffy_Pillow 9.0/100: 9% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(13), bloodsoaked, conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(3)
0:14.513 default Q lunar_strike Fluffy_Pillow 17.5/100: 18% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(12), bloodsoaked, conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.266 default N sunfire Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(11), bloodsoaked, conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.021 default R solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(10), bloodsoaked, conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.776 default O moonfire Fluffy_Pillow 42.0/100: 42% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(10), bloodsoaked, conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(4)
0:17.531 default R solar_wrath Fluffy_Pillow 45.5/100: 46% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(9), bloodsoaked, conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(4)
0:18.285 default Q lunar_strike Fluffy_Pillow 54.0/100: 54% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(8), bloodsoaked, conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.042 default R solar_wrath Fluffy_Pillow 70.5/100: 71% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(7), bloodsoaked, battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.797 default Q lunar_strike Fluffy_Pillow 79.0/100: 79% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(7), bloodsoaked, battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.555 default K starsurge Fluffy_Pillow 91.5/100: 92% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, overwhelming_power(6), bloodsoaked, battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.309 default P stellar_flare Fluffy_Pillow 52.0/100: 52% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(5), bloodsoaked_counter, battle_potion_of_intellect, ignition_mages_fuse(5)
0:22.061 default K starsurge Fluffy_Pillow 60.5/100: 61% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(4), bloodsoaked_counter(2), battle_potion_of_intellect, ignition_mages_fuse(5)
0:22.815 default R solar_wrath Fluffy_Pillow 21.0/100: 21% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(4), bloodsoaked_counter(2), battle_potion_of_intellect, ignition_mages_fuse(5)
0:23.569 default L sunfire Fluffy_Pillow 29.5/100: 30% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(3), bloodsoaked_counter(3), ignition_mages_fuse(5)
0:24.324 default Q lunar_strike Fluffy_Pillow 37.0/100: 37% astral_power bloodlust, arcanic_pulsar(7), lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(2), bloodsoaked_counter(4), ignition_mages_fuse(5)
0:25.259 default K starsurge Fluffy_Pillow 53.5/100: 54% astral_power bloodlust, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power, bloodsoaked_counter(5)
0:26.156 default Q lunar_strike Fluffy_Pillow 18.0/100: 18% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment(2), starlord(3), bloodsoaked_counter(7)
0:27.271 default Q lunar_strike Fluffy_Pillow 31.0/100: 31% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), bloodsoaked_counter(7)
0:28.385 default Q lunar_strike Fluffy_Pillow 43.5/100: 44% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), bloodsoaked_counter(7)
0:29.499 default R solar_wrath Fluffy_Pillow 60.5/100: 61% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment(2), starlord(3), bloodsoaked_counter(8)
0:30.254 default R solar_wrath Fluffy_Pillow 69.0/100: 69% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment, starlord(3), bloodsoaked_counter(9)
0:31.010 default R solar_wrath Fluffy_Pillow 77.5/100: 78% astral_power bloodlust, arcanic_pulsar(8), starlord(3), bloodsoaked_counter(11)
0:31.885 default R solar_wrath Fluffy_Pillow 86.0/100: 86% astral_power bloodlust, arcanic_pulsar(8), starlord(3), bloodsoaked_counter(13)
0:32.761 default K starsurge Fluffy_Pillow 94.5/100: 95% astral_power bloodlust, arcanic_pulsar(8), starlord(3), bloodsoaked_counter(15)
0:33.637 default R solar_wrath Fluffy_Pillow 67.0/100: 67% astral_power bloodlust, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), bloodsoaked_counter(16)
0:34.392 default K starsurge Fluffy_Pillow 75.5/100: 76% astral_power bloodlust, celestial_alignment, lunar_empowerment, starlord(3), bloodsoaked_counter(17)
0:35.153 default R solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), bloodsoaked_counter(17)
0:35.906 default Q lunar_strike Fluffy_Pillow 44.5/100: 45% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), bloodsoaked_counter(19)
0:36.876 default R solar_wrath Fluffy_Pillow 57.5/100: 57% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), bloodsoaked_counter(19)
0:37.638 default Q lunar_strike Fluffy_Pillow 66.0/100: 66% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), bloodsoaked_counter(20)
0:38.608 default R solar_wrath Fluffy_Pillow 78.5/100: 79% astral_power bloodlust, arcanic_pulsar, celestial_alignment, starlord(3), overwhelming_power(25), bloodsoaked_counter(22)
0:39.362 default M moonfire Fluffy_Pillow 87.0/100: 87% astral_power bloodlust, arcanic_pulsar, celestial_alignment, starlord(3), overwhelming_power(24), bloodsoaked_counter(24)
0:40.116 default J cancel_buff Fluffy_Pillow 90.5/100: 91% astral_power bloodlust, arcanic_pulsar, starlord(3), overwhelming_power(23), bloodsoaked_counter(24)
0:40.116 default K starsurge Fluffy_Pillow 90.5/100: 91% astral_power bloodlust, arcanic_pulsar, overwhelming_power(23), bloodsoaked_counter(24)
0:40.994 default K starsurge Fluffy_Pillow 51.0/100: 51% astral_power bloodlust, arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(23), bloodsoaked_counter(25)
0:41.848 default N sunfire Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(22), bloodsoaked_counter(25)
0:42.926 default Q lunar_strike Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(21), bloodsoaked_counter(25)
0:44.306 default Q lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(19), bloodsoaked_counter(27)
0:45.697 default K starsurge Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(2), overwhelming_power(18), bloodsoaked_counter(27)
0:46.792 default P stellar_flare Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(17), bloodsoaked_counter(28)
0:47.861 default R solar_wrath Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(16), bloodsoaked_counter(28)
0:48.772 default Q lunar_strike Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(15), bloodsoaked_counter(28)
0:50.141 default Q lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(13), bloodsoaked_counter(29)
0:51.523 default K starsurge Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), overwhelming_power(12), bloodsoaked_counter(30)
0:52.612 default R solar_wrath Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(11), bloodsoaked_counter(30)
0:53.541 default Q lunar_strike Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(10), bloodsoaked_counter(31)
0:54.937 default R solar_wrath Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), overwhelming_power(9), bloodsoaked_counter(32)
0:55.873 default Q lunar_strike Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(8), bloodsoaked_counter(32)
0:57.279 default R solar_wrath Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), overwhelming_power(6), bloodsoaked_counter(33)
0:58.225 default R solar_wrath Fluffy_Pillow 61.5/100: 62% astral_power arcanic_pulsar(5), starlord(3), overwhelming_power(5), bloodsoaked_counter(33), conch_of_dark_whispers
0:59.340 default R solar_wrath Fluffy_Pillow 70.5/100: 71% astral_power arcanic_pulsar(5), starlord(3), overwhelming_power(4), bloodsoaked_counter(34), conch_of_dark_whispers
1:00.460 default K starsurge Fluffy_Pillow 79.0/100: 79% astral_power arcanic_pulsar(5), overwhelming_power(3), bloodsoaked_counter(36), conch_of_dark_whispers
1:01.686 default K starsurge Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(2), bloodsoaked_counter(38), conch_of_dark_whispers
1:02.880 default N sunfire Fluffy_Pillow 0.5/100: 1% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power, bloodsoaked, conch_of_dark_whispers
1:03.961 default O moonfire Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), bloodsoaked, conch_of_dark_whispers
1:05.046 default Q lunar_strike Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), bloodsoaked, conch_of_dark_whispers
1:06.430 default Q lunar_strike Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), bloodsoaked, conch_of_dark_whispers
1:07.814 default R solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(7), solar_empowerment(3), starlord(2), bloodsoaked, conch_of_dark_whispers
1:08.738 default K starsurge Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(2), bloodsoaked, conch_of_dark_whispers
1:09.824 default P stellar_flare Fluffy_Pillow 3.5/100: 4% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), bloodsoaked, conch_of_dark_whispers
1:10.880 default R solar_wrath Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), bloodsoaked_counter(3), conch_of_dark_whispers
1:11.844 default Q lunar_strike Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), bloodsoaked_counter(3), conch_of_dark_whispers
1:13.291 default Q lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), bloodsoaked_counter(4)
1:14.739 default R solar_wrath Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), bloodsoaked_counter(4)
1:15.704 default R solar_wrath Fluffy_Pillow 63.0/100: 63% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), bloodsoaked_counter(5)
1:16.671 default R solar_wrath Fluffy_Pillow 72.0/100: 72% astral_power arcanic_pulsar(8), starlord(3), bloodsoaked_counter(6)
1:17.808 default N sunfire Fluffy_Pillow 80.5/100: 81% astral_power arcanic_pulsar(8), starlord(3), bloodsoaked_counter(6)
1:18.944 default R solar_wrath Fluffy_Pillow 84.5/100: 85% astral_power arcanic_pulsar(8), starlord(3), bloodsoaked_counter(8)
1:20.080 default J cancel_buff Fluffy_Pillow 93.0/100: 93% astral_power arcanic_pulsar(8), starlord(3), bloodsoaked_counter(10)
1:20.080 default K starsurge Fluffy_Pillow 93.0/100: 93% astral_power arcanic_pulsar(8), bloodsoaked_counter(10)
1:21.317 default R solar_wrath Fluffy_Pillow 66.0/100: 66% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, bloodsoaked_counter(10)
1:22.204 default K starsurge Fluffy_Pillow 74.5/100: 75% astral_power celestial_alignment, lunar_empowerment, starlord, bloodsoaked_counter(10)
1:23.249 default R solar_wrath Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), bloodsoaked_counter(12)
1:24.114 default Q lunar_strike Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(2), bloodsoaked_counter(14)
1:25.409 default K starsurge Fluffy_Pillow 56.5/100: 56% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), bloodsoaked_counter(16)
1:26.425 default M moonfire Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), bloodsoaked_counter(16)
1:27.414 default Q lunar_strike Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment(2), starlord(3), bloodsoaked_counter(17)
1:28.862 default R solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(3), starlord(3), bloodsoaked_counter(20)
1:29.829 default Q lunar_strike Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), bloodsoaked_counter(21), conch_of_dark_whispers
1:31.276 default R solar_wrath Fluffy_Pillow 59.5/100: 60% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(3), starlord(3), bloodsoaked_counter(24), conch_of_dark_whispers
1:32.241 default K starsurge Fluffy_Pillow 68.0/100: 68% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), bloodsoaked_counter(24), conch_of_dark_whispers
1:33.378 default P stellar_flare Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(3), bloodsoaked_counter(25), conch_of_dark_whispers
1:34.515 default H blood_of_the_enemy Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(3), bloodsoaked_counter(26), conch_of_dark_whispers
1:35.759 default N sunfire Fluffy_Pillow 38.5/100: 39% astral_power seething_rage, arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(3), bloodsoaked_counter(27), conch_of_dark_whispers
1:36.895 default R solar_wrath Fluffy_Pillow 42.5/100: 43% astral_power seething_rage, arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(3), bloodsoaked_counter(28), conch_of_dark_whispers
1:37.864 default Q lunar_strike Fluffy_Pillow 51.0/100: 51% astral_power seething_rage, arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), bloodsoaked_counter(29), conch_of_dark_whispers
1:39.314 default Q lunar_strike Fluffy_Pillow 64.0/100: 64% astral_power seething_rage, arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), bloodsoaked_counter(30), conch_of_dark_whispers
1:40.763 default K starsurge Fluffy_Pillow 81.0/100: 81% astral_power arcanic_pulsar(3), solar_empowerment(2), bloodsoaked_counter(31), conch_of_dark_whispers
1:42.002 default R solar_wrath Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord, bloodsoaked_counter(31), conch_of_dark_whispers
1:43.024 default K starsurge Fluffy_Pillow 54.5/100: 55% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord, bloodsoaked_counter(32), conch_of_dark_whispers
1:44.227 default R solar_wrath Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(2), bloodsoaked_counter(33), conch_of_dark_whispers
1:45.220 default O moonfire Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), bloodsoaked_counter(35), conch_of_dark_whispers
1:46.389 default Q lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), bloodsoaked_counter(36), conch_of_dark_whispers
1:47.878 default K starsurge Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), bloodsoaked_counter(36)
1:49.046 default R solar_wrath Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3), bloodsoaked_counter(38)
1:50.012 default Q lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(6), lunar_empowerment(3), solar_empowerment(2), starlord(3), bloodsoaked
1:51.359 default Q lunar_strike Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(3), bloodsoaked
1:52.705 default K starsurge Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), bloodsoaked
1:53.760 default N sunfire Fluffy_Pillow 0.5/100: 1% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(3), bloodsoaked
1:54.816 default R solar_wrath Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(3), bloodsoaked
1:55.716 default Q lunar_strike Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3), bloodsoaked
1:57.063 default P stellar_flare Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), bloodsoaked
1:58.120 default Q lunar_strike Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3)
1:59.566 default R solar_wrath Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3)
2:00.532 default R solar_wrath Fluffy_Pillow 60.0/100: 60% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3)
2:01.500 default K starsurge Fluffy_Pillow 73.0/100: 73% astral_power arcanic_pulsar(7)
2:02.737 default Q lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord
2:04.270 default K starsurge Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(8), solar_empowerment, starlord
2:05.472 default G use_items Fluffy_Pillow 23.5/100: 24% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2)
2:05.472 default R solar_wrath Fluffy_Pillow 23.5/100: 24% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), ignition_mages_fuse
2:06.300 default Q lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), ignition_mages_fuse
2:07.539 default K starsurge Fluffy_Pillow 45.0/100: 45% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), ignition_mages_fuse
2:08.512 default R solar_wrath Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), bloodsoaked_counter(2), ignition_mages_fuse
2:09.318 default Q lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), bloodsoaked_counter(2), ignition_mages_fuse
2:10.523 default M moonfire Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), bloodsoaked_counter(2), ignition_mages_fuse(2)
2:11.432 default Q lunar_strike Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord(3), bloodsoaked_counter(2), ignition_mages_fuse(2)
2:12.764 default K starsurge Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar, solar_empowerment, starlord(3), bloodsoaked_counter(2), ignition_mages_fuse(2)
2:13.809 default N sunfire Fluffy_Pillow 4.0/100: 4% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), bloodsoaked_counter(2), ignition_mages_fuse(3)
2:14.811 default Q lunar_strike Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(24), bloodsoaked_counter(2), ignition_mages_fuse(3)
2:15.996 default R solar_wrath Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3), overwhelming_power(23), bloodsoaked_counter(2), ignition_mages_fuse(3)
2:16.791 default R solar_wrath Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), overwhelming_power(22), bloodsoaked_counter(2), ignition_mages_fuse(3)
2:17.586 default R solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(2), starlord(3), overwhelming_power(21), bloodsoaked_counter(2), ignition_mages_fuse(4)
2:18.491 default Q lunar_strike Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(2), lunar_empowerment, starlord(3), overwhelming_power(20), bloodsoaked_counter(3), ignition_mages_fuse(4)
2:19.648 default R solar_wrath Fluffy_Pillow 59.0/100: 59% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), overwhelming_power(19), bloodsoaked_counter(4), ignition_mages_fuse(4)
2:20.423 default R solar_wrath Fluffy_Pillow 67.5/100: 68% astral_power arcanic_pulsar(2), starlord(3), overwhelming_power(18), bloodsoaked_counter(5), ignition_mages_fuse(4)
2:21.337 default P stellar_flare Fluffy_Pillow 76.0/100: 76% astral_power arcanic_pulsar(2), starlord(3), overwhelming_power(17), bloodsoaked_counter(7), ignition_mages_fuse(4)
2:22.253 default K starsurge Fluffy_Pillow 88.5/100: 89% astral_power arcanic_pulsar(2), overwhelming_power(16), bloodsoaked_counter(7), ignition_mages_fuse(5)
2:23.220 default K starsurge Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(15), bloodsoaked_counter(7), ignition_mages_fuse(5)
2:24.163 default Q lunar_strike Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(14), bloodsoaked_counter(7), ignition_mages_fuse(5)
2:25.334 default Q lunar_strike Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(13), bloodsoaked_counter(7), ignition_mages_fuse(5)
2:26.506 default R solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(4), solar_empowerment(3), starlord(2), overwhelming_power(12), bloodsoaked_counter(7)
2:27.457 default K starsurge Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(2), overwhelming_power(11), bloodsoaked_counter(7)
2:28.578 default R solar_wrath Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(10), bloodsoaked_counter(7)
2:29.509 default O moonfire Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(9), bloodsoaked_counter(7)
2:30.610 default N sunfire Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(8), bloodsoaked_counter(8)
2:31.714 default Q lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(7), bloodsoaked_counter(10)
2:33.124 default R solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(5), solar_empowerment(3), starlord(3), overwhelming_power(5), bloodsoaked_counter(12)
2:34.073 default K starsurge Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), overwhelming_power(4), bloodsoaked_counter(13)
2:35.192 default R solar_wrath Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(3), bloodsoaked_counter(16)
2:36.148 default Q lunar_strike Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(2), bloodsoaked_counter(16)
2:37.584 default R solar_wrath Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), overwhelming_power, bloodsoaked_counter(16)
2:38.546 default Q lunar_strike Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(3), bloodsoaked_counter(16)
2:39.993 default R solar_wrath Fluffy_Pillow 58.5/100: 59% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), bloodsoaked_counter(16)
2:40.961 default Q lunar_strike Fluffy_Pillow 67.0/100: 67% astral_power arcanic_pulsar(6), lunar_empowerment, starlord(3), bloodsoaked_counter(16)
2:42.407 default K starsurge Fluffy_Pillow 80.0/100: 80% astral_power arcanic_pulsar(6), solar_empowerment, bloodsoaked_counter(16)
2:43.646 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord, bloodsoaked_counter(16)
2:44.849 default P stellar_flare Fluffy_Pillow 1.5/100: 2% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(2), bloodsoaked_counter(17)
2:46.018 default R solar_wrath Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(2), bloodsoaked_counter(17)
2:47.011 default Q lunar_strike Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), bloodsoaked_counter(18)
2:48.500 default K starsurge Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), bloodsoaked_counter(19)
2:49.669 default N sunfire Fluffy_Pillow 13.0/100: 13% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), bloodsoaked_counter(19)
2:50.658 default R solar_wrath Fluffy_Pillow 20.5/100: 21% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), bloodsoaked_counter(21)
2:51.499 default Q lunar_strike Fluffy_Pillow 29.0/100: 29% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), bloodsoaked_counter(23)
2:52.759 default K starsurge Fluffy_Pillow 42.0/100: 42% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), bloodsoaked_counter(24)
2:53.747 default R solar_wrath Fluffy_Pillow 2.5/100: 3% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), bloodsoaked_counter(24)
2:54.588 default M moonfire Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), bloodsoaked_counter(25)
2:55.576 default Q lunar_strike Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment(2), starlord(3), bloodsoaked_counter(25)
2:57.024 default R solar_wrath Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(3), starlord(3), bloodsoaked_counter(25)
2:57.992 default Q lunar_strike Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(2), starlord(3), bloodsoaked_counter(26)
2:59.439 default R solar_wrath Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar, solar_empowerment(2), starlord(3), bloodsoaked_counter(27)
3:00.406 default R solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power arcanic_pulsar, solar_empowerment, starlord(3), bloodsoaked_counter(27)
3:01.373 default Q lunar_strike Fluffy_Pillow 66.5/100: 67% astral_power arcanic_pulsar, lunar_empowerment, starlord(3), bloodsoaked_counter(28)
3:02.821 default K starsurge Fluffy_Pillow 79.5/100: 80% astral_power arcanic_pulsar, overwhelming_power(24), bloodsoaked_counter(31)
3:03.958 default I celestial_alignment Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(23), bloodsoaked_counter(31)
3:04.922 default E potion Fluffy_Pillow 81.0/100: 81% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(22), bloodsoaked_counter(31)
3:04.922 default F berserking Fluffy_Pillow 81.0/100: 81% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(22), bloodsoaked_counter(31), battle_potion_of_intellect
3:04.922 default H blood_of_the_enemy Fluffy_Pillow 81.0/100: 81% astral_power berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(22), bloodsoaked_counter(31), battle_potion_of_intellect
3:05.801 default K starsurge Fluffy_Pillow 81.5/100: 82% astral_power berserking, seething_rage, arcanic_pulsar(2), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(21), bloodsoaked_counter(31), battle_potion_of_intellect
3:06.685 default N sunfire Fluffy_Pillow 46.0/100: 46% astral_power berserking, seething_rage, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(20), bloodsoaked_counter(35), battle_potion_of_intellect
3:07.545 default R solar_wrath Fluffy_Pillow 50.0/100: 50% astral_power berserking, seething_rage, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(19), bloodsoaked_counter(38), battle_potion_of_intellect
3:08.301 default K starsurge Fluffy_Pillow 62.5/100: 63% astral_power berserking, seething_rage, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(18), bloodsoaked, battle_potion_of_intellect
3:09.109 default P stellar_flare Fluffy_Pillow 23.0/100: 23% astral_power berserking, seething_rage, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(17), bloodsoaked, battle_potion_of_intellect
3:09.898 default R solar_wrath Fluffy_Pillow 31.5/100: 32% astral_power berserking, seething_rage, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(17), bloodsoaked, battle_potion_of_intellect
3:10.653 default Q lunar_strike Fluffy_Pillow 40.0/100: 40% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(16), bloodsoaked, battle_potion_of_intellect
3:11.660 default K starsurge Fluffy_Pillow 56.5/100: 56% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(15), bloodsoaked, battle_potion_of_intellect
3:12.454 default R solar_wrath Fluffy_Pillow 17.0/100: 17% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(14), bloodsoaked, battle_potion_of_intellect
3:13.206 default O moonfire Fluffy_Pillow 25.5/100: 26% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(13), bloodsoaked, battle_potion_of_intellect
3:14.006 default R solar_wrath Fluffy_Pillow 29.0/100: 29% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(12), bloodsoaked, battle_potion_of_intellect
3:14.762 default Q lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(12), bloodsoaked, battle_potion_of_intellect
3:15.785 default K starsurge Fluffy_Pillow 50.5/100: 51% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(11), bloodsoaked, battle_potion_of_intellect
3:16.590 default R solar_wrath Fluffy_Pillow 11.0/100: 11% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(10), battle_potion_of_intellect
3:17.343 default Q lunar_strike Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(9), battle_potion_of_intellect
3:18.561 default R solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(8), bloodsoaked_counter, battle_potion_of_intellect
3:19.522 default Q lunar_strike Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(7), bloodsoaked_counter(2), battle_potion_of_intellect
3:20.750 default R solar_wrath Fluffy_Pillow 57.5/100: 57% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(6), bloodsoaked_counter(3), battle_potion_of_intellect
3:21.719 default Q lunar_strike Fluffy_Pillow 66.0/100: 66% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(5), bloodsoaked_counter(3), battle_potion_of_intellect
3:22.955 default K starsurge Fluffy_Pillow 79.0/100: 79% astral_power arcanic_pulsar(6), celestial_alignment, overwhelming_power(4), bloodsoaked_counter(4), battle_potion_of_intellect
3:24.016 default K starsurge Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(2), bloodsoaked_counter(5), battle_potion_of_intellect
3:25.208 default N sunfire Fluffy_Pillow 0.5/100: 1% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power, bloodsoaked_counter(6), battle_potion_of_intellect
3:26.372 default Q lunar_strike Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), bloodsoaked_counter(7), battle_potion_of_intellect
3:27.859 default Q lunar_strike Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), bloodsoaked_counter(7), battle_potion_of_intellect
3:29.347 default R solar_wrath Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(2), bloodsoaked_counter(7), battle_potion_of_intellect
3:30.341 default R solar_wrath Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(8), solar_empowerment, starlord(2), bloodsoaked_counter(8)
3:31.332 default K starsurge Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(8), starlord(2), bloodsoaked_counter(8)
3:32.501 default R solar_wrath Fluffy_Pillow 28.5/100: 28% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), bloodsoaked_counter(9)
3:33.342 default P stellar_flare Fluffy_Pillow 37.0/100: 37% astral_power celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(25), bloodsoaked_counter(10)
3:34.248 default K starsurge Fluffy_Pillow 49.5/100: 50% astral_power celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(24), bloodsoaked_counter(11)
3:35.154 default R solar_wrath Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(23), bloodsoaked_counter(12)
3:35.928 default Q lunar_strike Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(23), bloodsoaked_counter(14)
3:37.087 default M moonfire Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(21), bloodsoaked_counter(15)
3:38.003 default Q lunar_strike Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar, lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(20), bloodsoaked_counter(17)
3:39.352 default R solar_wrath Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar, starlord(3), torrent_of_elements, overwhelming_power(19), bloodsoaked_counter(17)
3:40.413 default R solar_wrath Fluffy_Pillow 56.5/100: 56% astral_power arcanic_pulsar, starlord(3), torrent_of_elements, overwhelming_power(25), bloodsoaked_counter(19)
3:41.452 default R solar_wrath Fluffy_Pillow 65.5/100: 66% astral_power arcanic_pulsar, starlord(3), torrent_of_elements, overwhelming_power(24), bloodsoaked_counter(19)
3:42.494 default N sunfire Fluffy_Pillow 74.0/100: 74% astral_power arcanic_pulsar, starlord(3), torrent_of_elements, overwhelming_power(23), bloodsoaked_counter(20)
3:43.541 default K starsurge Fluffy_Pillow 78.0/100: 78% astral_power arcanic_pulsar, torrent_of_elements, overwhelming_power(22), bloodsoaked_counter(20)
3:44.686 default Q lunar_strike Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(21), bloodsoaked_counter(22)
3:46.106 default K starsurge Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(19), bloodsoaked_counter(22)
3:47.230 default R solar_wrath Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord(2), torrent_of_elements, overwhelming_power(18), bloodsoaked_counter(23)
3:48.160 default Q lunar_strike Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(17), bloodsoaked_counter(23)
3:49.559 default R solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(16), bloodsoaked_counter(23)
3:50.495 default K starsurge Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(3), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(15), bloodsoaked_counter(24)
3:51.602 default Q lunar_strike Fluffy_Pillow 3.0/100: 3% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(14), bloodsoaked_counter(25)
3:52.977 default R solar_wrath Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), overwhelming_power(13), bloodsoaked_counter(25)
3:53.898 default R solar_wrath Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(4), solar_empowerment, starlord(3), overwhelming_power(12), bloodsoaked_counter(25)
3:54.823 default R solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(4), starlord(3), overwhelming_power(11), bloodsoaked_counter(25), conch_of_dark_whispers
3:55.914 default K starsurge Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(4), starlord(3), overwhelming_power(10), bloodsoaked_counter(26), conch_of_dark_whispers
3:57.010 default O moonfire Fluffy_Pillow 3.0/100: 3% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(8), bloodsoaked_counter(30), conch_of_dark_whispers
3:58.115 default P stellar_flare Fluffy_Pillow 6.5/100: 7% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(7), bloodsoaked_counter(32), conch_of_dark_whispers
3:59.223 default Q lunar_strike Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(6), bloodsoaked_counter(32), conch_of_dark_whispers
4:00.638 default N sunfire Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), overwhelming_power(5), bloodsoaked_counter(33), conch_of_dark_whispers
4:01.754 default R solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), overwhelming_power(4), bloodsoaked_counter(34), conch_of_dark_whispers
4:02.705 default R solar_wrath Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(5), starlord(3), overwhelming_power(3), bloodsoaked_counter(34), conch_of_dark_whispers
4:03.828 default K starsurge Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar(5), overwhelming_power(2), bloodsoaked_counter(36), conch_of_dark_whispers
4:05.056 default Q lunar_strike Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord, bloodsoaked_counter(36), conch_of_dark_whispers
4:06.588 default G use_items Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord, bloodsoaked_counter(38), conch_of_dark_whispers
4:06.588 default R solar_wrath Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord, bloodsoaked_counter(38), conch_of_dark_whispers, ignition_mages_fuse
4:07.566 default R solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(6), solar_empowerment, starlord, overwhelming_power(25), bloodsoaked_counter(39), conch_of_dark_whispers, ignition_mages_fuse
4:08.465 default K starsurge Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(6), starlord, overwhelming_power(24), bloodsoaked_counter(39), conch_of_dark_whispers, ignition_mages_fuse
4:09.527 default Q lunar_strike Fluffy_Pillow 1.0/100: 1% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(23), bloodsoaked_counter(10), bloodsoaked, conch_of_dark_whispers, ignition_mages_fuse
4:10.761 default R solar_wrath Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(2), overwhelming_power(22), bloodsoaked_counter(10), bloodsoaked, ignition_mages_fuse(2)
4:11.561 default R solar_wrath Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(7), solar_empowerment, starlord(2), overwhelming_power(21), bloodsoaked_counter(10), bloodsoaked, ignition_mages_fuse(2)
4:12.361 default R solar_wrath Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(7), starlord(2), overwhelming_power(20), bloodsoaked_counter(10), bloodsoaked, ignition_mages_fuse(2)
4:13.305 default K starsurge Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(7), starlord(2), overwhelming_power(19), bloodsoaked_counter(10), bloodsoaked, ignition_mages_fuse(2)
4:14.252 default Q lunar_strike Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(18), bloodsoaked_counter(10), bloodsoaked, ignition_mages_fuse(2)
4:15.429 default R solar_wrath Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(17), bloodsoaked_counter(10), bloodsoaked, ignition_mages_fuse(3)
4:16.188 default R solar_wrath Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(16), bloodsoaked_counter(10), bloodsoaked, ignition_mages_fuse(3)
4:17.084 default R solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(15), bloodsoaked_counter(10), ignition_mages_fuse(3)
4:18.039 default N sunfire Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(14), bloodsoaked_counter(10), ignition_mages_fuse(3)
4:19.000 default O moonfire Fluffy_Pillow 54.5/100: 55% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(13), bloodsoaked_counter(11), ignition_mages_fuse(4)
4:19.928 default R solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(13), bloodsoaked_counter(11), ignition_mages_fuse(4)
4:20.857 default P stellar_flare Fluffy_Pillow 66.5/100: 67% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(12), bloodsoaked_counter(12), ignition_mages_fuse(4)
4:21.787 default R solar_wrath Fluffy_Pillow 75.5/100: 76% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(11), bloodsoaked_counter(12), ignition_mages_fuse(4)
4:22.721 default R solar_wrath Fluffy_Pillow 84.0/100: 84% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(10), bloodsoaked_counter(13), ignition_mages_fuse(5)
4:23.623 default J cancel_buff Fluffy_Pillow 92.5/100: 93% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(9), bloodsoaked_counter(13), ignition_mages_fuse(5)
4:23.623 default K starsurge Fluffy_Pillow 92.5/100: 93% astral_power arcanic_pulsar(8), overwhelming_power(9), bloodsoaked_counter(13), ignition_mages_fuse(5)
4:24.610 default R solar_wrath Fluffy_Pillow 65.0/100: 65% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(8), bloodsoaked_counter(14), ignition_mages_fuse(5)
4:25.364 default K starsurge Fluffy_Pillow 73.5/100: 74% astral_power celestial_alignment, lunar_empowerment, starlord, overwhelming_power(7), bloodsoaked_counter(14), ignition_mages_fuse(5)
4:26.202 default R solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(6), bloodsoaked_counter(14), ignition_mages_fuse(5)
4:26.958 default K starsurge Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), overwhelming_power(6), bloodsoaked_counter(15)
4:27.952 default R solar_wrath Fluffy_Pillow 3.5/100: 4% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(5), bloodsoaked_counter(17)
4:28.778 default Q lunar_strike Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(4), bloodsoaked_counter(18)
4:30.018 default L sunfire Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(2), bloodsoaked_counter(19)
4:31.000 default Q lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(2), lunar_empowerment(2), starlord(3), overwhelming_power, bloodsoaked_counter(19)
4:32.445 default K starsurge Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(2), lunar_empowerment, starlord(3), bloodsoaked_counter(19)
4:33.582 default Q lunar_strike Fluffy_Pillow 2.0/100: 2% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, bloodsoaked_counter(20)
4:35.030 default H blood_of_the_enemy Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, bloodsoaked_counter(20)
4:36.167 default Q lunar_strike Fluffy_Pillow 16.0/100: 16% astral_power seething_rage, arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, bloodsoaked_counter(22)
4:37.616 default R solar_wrath Fluffy_Pillow 29.0/100: 29% astral_power seething_rage, arcanic_pulsar(3), solar_empowerment(2), starlord(3), torrent_of_elements, bloodsoaked_counter(23)
4:38.582 default R solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power seething_rage, arcanic_pulsar(3), solar_empowerment, starlord(3), torrent_of_elements, bloodsoaked_counter(23)
4:39.548 default R solar_wrath Fluffy_Pillow 50.0/100: 50% astral_power seething_rage, arcanic_pulsar(3), starlord(3), torrent_of_elements, bloodsoaked_counter(25)
4:40.684 default R solar_wrath Fluffy_Pillow 59.0/100: 59% astral_power arcanic_pulsar(3), starlord(3), torrent_of_elements, bloodsoaked_counter(26)
4:41.820 default K starsurge Fluffy_Pillow 67.5/100: 68% astral_power arcanic_pulsar(3), lunar_empowerment, starlord(3), torrent_of_elements, bloodsoaked_counter(28)
4:42.957 default Q lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, bloodsoaked_counter(28)

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 16238 14762 13761
Intellect 1467 -3 13346 11714 9693 (6045)
Spirit 0 0 0 0 0
Health 324760 295240 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 13346 11714 0
Crit 15.68% 15.68% 769
Haste 21.51% 21.51% 1463
Damage / Heal Versatility 4.81% 4.81% 409
ManaReg per Second 2378 640 0
Attack Power 13880 12183 0
Mastery 55.20% 55.20% 2005
Armor 2962 2962 2962
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 447.00
Local Head Hood of the Slithering Loa
ilevel: 450, stats: { 407 Armor, +1145 AgiInt, +2255 Sta }
Local Neck Heart of Azeroth
ilevel: 463, stats: { +325 Haste, +325 Crit, +325 Mastery, +719 Sta, +382 StrAgiInt }
Local Shoulders Gorak Tul's Mantle
ilevel: 450, stats: { 376 Armor, +859 AgiInt, +1691 Sta }
Local Chest Spymaster's Wrap
ilevel: 450, stats: { 501 Armor, +1145 AgiInt, +2255 Sta }
Local Waist Beloved Monarch's Waistwrap
ilevel: 445, stats: { 271 Armor, +431 AgiInt, +789 Sta, +147 Mastery, +82 Crit }
Local Legs Leggings of the Stormborn
ilevel: 445, stats: { 422 Armor, +575 AgiInt, +1053 Sta, +179 Vers, +126 Crit }
Local Feet Ancient Tempest Striders
ilevel: 445, stats: { 331 Armor, +431 AgiInt, +789 Sta, +134 Mastery, +95 Haste }
Local Wrists Tideblood Bracers
ilevel: 445, stats: { 211 Armor, +323 AgiInt, +592 Sta, +105 Haste, +66 Crit }
Local Hands Gloves of Incomparable Beauty
ilevel: 445, stats: { 301 Armor, +431 AgiInt, +789 Sta, +134 Haste, +95 Mastery }
Local Finger1 Boralus Noble's Seal
ilevel: 445, stats: { +592 Sta, +369 Mastery, +169 Haste }, enchant: { +60 Haste }
Local Finger2 Cursed Lover's Ring
ilevel: 445, stats: { +592 Sta, +307 Haste, +230 Vers }, enchant: { +60 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 445, stats: { +546 Int }
Local Trinket2 Conch of Dark Whispers
ilevel: 445, stats: { +546 Int }
Local Back Cloak of Ill Tidings
ilevel: 445, stats: { 142 Armor, +323 StrAgiInt, +592 Sta, +110 Mastery, +61 Crit }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 445, weapon: { 661 - 896, 3.6 }, stats: { +575 Int, +1053 Sta, +109 Haste, +109 Crit, +109 Mastery, +1981 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="blood of the enemy"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
talents=1000231
azerite_override=lifespeed:450/heed_my_call:450/overwhelming_power:450/streaking_stars:450/streaking_stars:450/streaking_stars:450/arcanic_pulsar:450/loyal_to_the_end:450/loyal_to_the_end:450

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6&active_enemies=1
actions+=/potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
actions+=/blood_fury,if=buff.ca_inc.up
actions+=/berserking,if=buff.ca_inc.up
actions+=/arcane_torrent,if=buff.ca_inc.up
actions+=/lights_judgment,if=buff.ca_inc.up
actions+=/fireblood,if=buff.ca_inc.up
actions+=/ancestral_call,if=buff.ca_inc.up
actions+=/use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
actions+=/use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
actions+=/use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
actions+=/celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=hood_of_the_slithering_loa,id=159318,ilevel=450
neck=heart_of_azeroth,id=158075,ilevel=463
shoulders=gorak_tuls_mantle,id=159339,ilevel=450
back=cloak_of_ill_tidings,id=168391,ilevel=445
chest=spymasters_wrap,id=155860,ilevel=450
wrists=tideblood_bracers,id=168377,ilevel=445
hands=gloves_of_incomparable_beauty,id=168887,ilevel=445
waist=beloved_monarchs_waistwrap,id=168871,ilevel=445
legs=leggings_of_the_stormborn,id=168378,ilevel=445
feet=ancient_tempest_striders,id=168380,ilevel=445
finger1=boralus_nobles_seal,id=168889,ilevel=445,enchant=60haste
finger2=cursed_lovers_ring,id=168891,ilevel=445,enchant=60haste
trinket1=ignition_mages_fuse,id=159615,ilevel=445
trinket2=conch_of_dark_whispers,id=159620,ilevel=445
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=445,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=447.20
# gear_stamina=13761
# gear_intellect=9693
# gear_crit_rating=769
# gear_haste_rating=1364
# gear_mastery_rating=1289
# gear_versatility_rating=409
# gear_armor=2962

focusing iris : 41754 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
41754.4 41754.4 20.1 / 0.048% 4898.6 / 11.7% 4849.8
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.6 8.5 Astral Power 0.00% 60.7 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Stellar Flare (Balance Druid)
  • 100: Shooting Stars (Balance Druid)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
focusing iris 41754
Heed My Call 311 (444) 0.7% (1.1%) 8.6 32.09sec 15484 0 Direct 8.6 9128 18259 10837 18.7%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.59 8.59 0.00 0.00 0.0000 0.0000 93079.53 93079.53 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.98 81.29% 9128.23 8921 9813 9128.10 0 9813 63734 63734 0.00
crit 1.61 18.71% 18258.75 17842 19626 14693.53 0 19626 29345 29345 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 133 0.3% 8.6 32.09sec 4647 0 Direct 8.6 3912 7825 4647 18.8%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.59 8.59 0.00 0.00 0.0000 0.0000 39916.25 39916.25 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.98 81.21% 3912.12 3823 4206 3911.93 0 4206 27290 27290 0.00
crit 1.61 18.79% 7825.01 7646 8411 6339.78 0 8411 12627 12627 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 6159 14.8% 81.5 3.59sec 22614 18179 Direct 81.5 19049 38076 22614 18.7%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 81.52 81.52 0.00 0.00 1.2440 0.0000 1843447.87 1843447.87 0.00 18178.53 18178.53
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 66.25 81.27% 19048.89 10135 24211 19055.56 18317 20200 1261931 1261931 0.00
crit 15.27 18.73% 38075.91 20270 48422 38087.31 34097 44321 581517 581517 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 2985 7.2% 14.2 21.29sec 62985 64781 Direct 14.2 3273 6545 3884 18.7%  
Periodic 233.4 3027 6050 3591 18.7% 99.3%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.18 14.18 233.39 233.39 0.9723 1.2751 893270.80 893270.80 0.00 2868.70 64781.41
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.54 81.34% 3273.28 2981 4065 3274.76 3003 3605 37758 37758 0.00
crit 2.65 18.66% 6544.91 5963 8130 6193.70 0 8130 17325 17325 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 189.8 81.33% 3026.94 2 3785 3028.34 2943 3165 574600 574600 0.00
crit 43.6 18.67% 6050.43 22 7570 6053.17 5681 6570 263587 263587 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Shooting Stars 961 2.3% 46.5 6.30sec 6177 0 Direct 46.5 5201 10400 6177 18.8%  

Stats details: shooting_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.54 46.54 0.00 0.00 0.0000 0.0000 287507.88 287507.88 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.80 81.23% 5201.34 4769 6503 5203.75 4860 5668 196634 196634 0.00
crit 8.74 18.77% 10399.93 9539 13006 10400.63 0 13006 90874 90874 0.00
 
 

Action details: shooting_stars

Static Values
  • id:202497
  • school:astral
  • resource:none
  • range:50000.0
  • travel_speed:0.8000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating ${$202497m2/10} Astral Power.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.360000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Solar Wrath 3494 (5531) 8.4% (13.3%) 100.8 2.92sec 16424 18819 Direct 101.3 8703 17399 10328 18.7%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 100.79 101.27 0.00 0.00 0.8728 0.0000 1045908.60 1045908.60 0.00 18818.83 18818.83
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 82.34 81.31% 8702.80 7949 10838 8708.21 8399 9168 716574 716574 0.00
crit 18.93 18.69% 17399.26 15898 21676 17408.05 15898 19687 329334 329334 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (solar_empowerment) 2036 4.9% 78.4 3.74sec 7776 0 Direct 78.4 7776 0 7776 0.0%  

Stats details: solar_empowerment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 78.37 78.37 0.00 0.00 0.0000 0.0000 609433.71 609433.71 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 78.37 100.00% 7776.25 5962 16257 7780.09 6785 9130 609434 609434 0.00
 
 

Action details: solar_empowerment

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:5961.69
  • base_dd_max:5961.69
  • base_dd_mult:1.00
 
Starsurge 14258 34.2% 64.4 4.70sec 66278 65913 Direct 64.1 56040 112002 66488 18.7%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 64.35 64.15 0.00 0.00 1.0056 0.0000 4265202.15 4265202.15 0.00 65912.57 65912.57
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 52.17 81.33% 56040.06 51347 69612 56065.85 54097 59109 2923772 2923772 0.00
crit 11.98 18.67% 112001.55 102695 139223 112056.55 102695 139223 1341431 1341431 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Stellar Flare 1938 4.6% 12.8 23.56sec 45313 46253 Direct 12.8 2790 5583 3304 18.4%  
Periodic 231.0 1961 3921 2327 18.7% 98.5%

Stats details: stellar_flare

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.80 12.80 230.97 230.97 0.9797 1.2772 579828.19 579828.19 0.00 1885.45 46253.05
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.44 81.58% 2789.61 2570 3504 2791.47 2570 3074 29120 29120 0.00
crit 2.36 18.42% 5583.07 5140 7009 5169.99 0 7009 13160 13160 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 187.8 81.31% 1961.08 4 2453 1962.00 1907 2049 368299 368299 0.00
crit 43.2 18.69% 3920.92 34 4906 3922.57 3702 4252 169249 169249 0.00
 
 

Action details: stellar_flare

Static Values
  • id:202347
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
Spelldata
  • id:202347
  • name:Stellar Flare
  • school:astral
  • tooltip:Suffering $w2 Astral damage every $t2 sec.
  • description:Burns the target for {$s1=0} Astral damage, and then an additional $o2 damage over {$d=24 seconds}. |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.125000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.087500
  • base_td:0.00
  • base_td_mult:0.82
  • dot_duration:24.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Streaking Star (s) 6169 14.7% 94.4 2.98sec 19440 0 Direct 94.4 16388 32783 19440 18.6%  

Stats details: streaking_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 94.44 94.44 0.00 0.00 0.0000 0.0000 1835969.82 1835969.82 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 76.87 81.39% 16388.27 16021 17623 16388.39 16021 17294 1259715 1259715 0.00
crit 17.58 18.61% 32783.17 32042 35246 32782.25 32042 35086 576255 576255 0.00
 
 

Action details: streaking_stars

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 3310 7.9% 17.6 17.01sec 56185 57206 Direct 17.6 4497 8994 5333 18.6%  
Periodic 232.5 3251 6497 3856 18.6% 99.0%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.63 17.63 232.49 232.49 0.9822 1.2759 990404.82 990404.82 0.00 3154.73 57205.85
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.35 81.41% 4496.65 4112 5607 4498.17 4174 4877 64530 64530 0.00
crit 3.28 18.59% 8994.40 8225 11214 8732.75 0 11214 29474 29474 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 189.2 81.36% 3250.54 2 4065 3252.07 3166 3401 614844 614844 0.00
crit 43.3 18.64% 6497.35 5 8130 6500.43 6087 7052 281557 281557 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Simple Action Stats Execute Interval
focusing iris
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:focusing iris
  • harmful:false
  • if_expr:
 
Berserking 2.0 182.66sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.0 182.47sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.8714 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:251837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:focusing iris
  • harmful:false
  • if_expr:
 
Bountiful Captain's Feast (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:259410
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:focusing iris
  • harmful:false
  • if_expr:
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Battle Potion of Intellect (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:279151
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 7.6 56.6 42.1sec 4.7sec 93.40% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:11.29%
  • arcanic_pulsar_2:11.31%
  • arcanic_pulsar_3:11.62%
  • arcanic_pulsar_4:10.81%
  • arcanic_pulsar_5:12.52%
  • arcanic_pulsar_6:11.02%
  • arcanic_pulsar_7:11.75%
  • arcanic_pulsar_8:13.08%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 187.4sec 0.0sec 16.24% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.24%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Battle-Scarred Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Berserking 2.0 0.0 182.6sec 182.6sec 8.12% 8.32% 0.0(0.0) 2.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast) 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Celestial Alignment 7.9 0.0 40.0sec 40.0sec 26.70% 33.06% 0.0(0.0) 7.7

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:26.70%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Conch of Dark Whispers 4.3 1.2 61.0sec 45.6sec 23.70% 0.00% 1.2(1.2) 4.1

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_conch_of_dark_whispers
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Conch of Dark Whispers

Stat Buff details

  • stat:crit_rating
  • amount:913.59

Stack Uptimes

  • conch_of_dark_whispers_1:23.70%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271071
  • name:Conch of Dark Whispers
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc271072=Your spells have a chance to grant you {$271071s1=649} Critical Strike for {$271071d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Focused Energy 1.0 381.1 0.0sec 0.8sec 100.00% 99.73% 374.1(374.1) 0.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_focused_energy
  • max_stacks:10
  • duration:4.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:35.52

Stack Uptimes

  • focused_energy_3:0.41%
  • focused_energy_4:0.31%
  • focused_energy_5:0.41%
  • focused_energy_6:0.21%
  • focused_energy_7:0.20%
  • focused_energy_8:0.20%
  • focused_energy_9:0.19%
  • focused_energy_10:98.07%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:295248
  • name:Focused Energy
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc295246=Your damaging spells and abilities grant you {$s2=0} Haste for {$295248d=4 seconds}, stacking up to {$295248u=10} times. This Haste is lost if you stop using spells or abilities against the initial target.$?a295252[ When you have no stacks of Focused Energy, generate {$s1=1} stacks from your first damaging spell or ability.][]}
  • max_stacks:10
  • duration:4.00
  • cooldown:0.00
  • default_chance:101.00%
Ignition Mage's Fuse 3.0 0.0 120.3sec 120.3sec 19.25% 0.00% 2.8(2.8) 2.8

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:366.08

Stack Uptimes

  • ignition_mages_fuse_1:3.96%
  • ignition_mages_fuse_2:3.90%
  • ignition_mages_fuse_3:3.85%
  • ignition_mages_fuse_4:3.80%
  • ignition_mages_fuse_5:3.74%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lunar Empowerment 36.9 47.8 8.2sec 3.6sec 81.66% 99.73% 2.1(2.1) 0.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:35.89%
  • lunar_empowerment_2:30.90%
  • lunar_empowerment_3:14.87%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Moonkin Form 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Nature's Balance 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 399.0(399.0) 0.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_natures_balance
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.75

Stack Uptimes

  • natures_balance_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202430
  • name:Nature's Balance
  • tooltip:Grants $m3 Astral Power every $m4 sec while in combat or while below 50 Astral Power.
  • description:While in combat you generate $m3 Astral Power every $m4 sec. While out of combat your Astral Power rebalances to 50 instead of depleting to empty.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Overwhelming Power 4.7 3.7 63.3sec 32.6sec 49.53% 0.00% 3.7(52.2) 0.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.40%
  • overwhelming_power_2:1.44%
  • overwhelming_power_3:1.48%
  • overwhelming_power_4:1.53%
  • overwhelming_power_5:1.57%
  • overwhelming_power_6:1.62%
  • overwhelming_power_7:1.66%
  • overwhelming_power_8:1.71%
  • overwhelming_power_9:1.76%
  • overwhelming_power_10:1.81%
  • overwhelming_power_11:1.87%
  • overwhelming_power_12:1.93%
  • overwhelming_power_13:1.98%
  • overwhelming_power_14:2.04%
  • overwhelming_power_15:2.11%
  • overwhelming_power_16:2.17%
  • overwhelming_power_17:2.24%
  • overwhelming_power_18:2.31%
  • overwhelming_power_19:2.38%
  • overwhelming_power_20:2.46%
  • overwhelming_power_21:2.54%
  • overwhelming_power_22:2.62%
  • overwhelming_power_23:2.70%
  • overwhelming_power_24:2.78%
  • overwhelming_power_25:1.41%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Solar Empowerment 27.4 53.2 10.9sec 3.7sec 84.44% 77.52% 0.2(0.2) 0.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:29.59%
  • solar_empowerment_2:38.80%
  • solar_empowerment_3:16.06%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starlord 15.3 49.0 20.2sec 4.7sec 97.93% 93.15% 18.8(18.8) 11.2

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:13.27%
  • starlord_2:21.66%
  • starlord_3:63.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.3 1.1 61.0sec 45.7sec 23.65% 0.00% 1.1(1.1) 4.0

Buff details

  • buff initial source:focusing iris
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.65%

Trigger Attempt Success

  • trigger_pct:99.98%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
focusing iris
starsurge Astral Power 64.4 2574.1 40.0 40.0 1656.9
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 101.79 814.24 (32.10%) 8.00 0.06 0.01%
celestial_alignment Astral Power 2.00 80.00 (3.15%) 40.00 0.00 0.00%
sunfire Astral Power 17.63 52.88 (2.08%) 3.00 0.00 0.00%
shooting_stars Astral Power 46.54 186.17 (7.34%) 4.00 0.00 0.00%
moonfire Astral Power 14.18 42.55 (1.68%) 3.00 0.00 0.00%
stellar_flare Astral Power 12.80 102.37 (4.04%) 8.00 0.00 0.00%
lunar_strike Astral Power 81.52 978.16 (38.56%) 12.00 0.07 0.01%
natures_balance Astral Power 400.01 200.00 (7.88%) 0.50 0.00 0.00%
arcanic_pulsar Astral Power 6.68 80.16 (3.16%) 12.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 8.47 8.59
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 19.76 0.00 67.50
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data focusing iris Fight Length
Count 15384
Mean 299.63
Minimum 240.01
Maximum 359.99
Spread ( max - min ) 119.97
Range [ ( max - min ) / 2 * 100% ] 20.02%
DPS
Sample Data focusing iris Damage Per Second
Count 15384
Mean 41754.42
Minimum 37732.86
Maximum 47299.23
Spread ( max - min ) 9566.37
Range [ ( max - min ) / 2 * 100% ] 11.46%
Standard Deviation 1273.8037
5th Percentile 39755.95
95th Percentile 43956.15
( 95th Percentile - 5th Percentile ) 4200.20
Mean Distribution
Standard Deviation 10.2699
95.00% Confidence Intervall ( 41734.29 - 41774.55 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 36
0.1% Error 3576
0.1 Scale Factor Error with Delta=300 13852
0.05 Scale Factor Error with Delta=300 55405
0.01 Scale Factor Error with Delta=300 1385125
Priority Target DPS
Sample Data focusing iris Priority Target Damage Per Second
Count 15384
Mean 41754.42
Minimum 37732.86
Maximum 47299.23
Spread ( max - min ) 9566.37
Range [ ( max - min ) / 2 * 100% ] 11.46%
Standard Deviation 1273.8037
5th Percentile 39755.95
95th Percentile 43956.15
( 95th Percentile - 5th Percentile ) 4200.20
Mean Distribution
Standard Deviation 10.2699
95.00% Confidence Intervall ( 41734.29 - 41774.55 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 36
0.1% Error 3576
0.1 Scale Factor Error with Delta=300 13852
0.05 Scale Factor Error with Delta=300 55405
0.01 Scale Factor Error with Delta=300 1385125
DPS(e)
Sample Data focusing iris Damage Per Second (Effective)
Count 15384
Mean 41754.42
Minimum 37732.86
Maximum 47299.23
Spread ( max - min ) 9566.37
Range [ ( max - min ) / 2 * 100% ] 11.46%
Damage
Sample Data focusing iris Damage
Count 15384
Mean 12483969.63
Minimum 9703103.97
Maximum 15764264.43
Spread ( max - min ) 6061160.46
Range [ ( max - min ) / 2 * 100% ] 24.28%
DTPS
Sample Data focusing iris Damage Taken Per Second
Count 15384
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data focusing iris Healing Per Second
Count 15384
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data focusing iris Healing Per Second (Effective)
Count 15384
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data focusing iris Heal
Count 15384
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data focusing iris Healing Taken Per Second
Count 15384
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data focusing iris Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data focusing irisTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data focusing iris Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
E 1.00 potion,if=buff.ca_inc.remains>6&active_enemies=1
0.00 potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
0.00 blood_fury,if=buff.ca_inc.up
F 2.00 berserking,if=buff.ca_inc.up
0.00 arcane_torrent,if=buff.ca_inc.up
0.00 lights_judgment,if=buff.ca_inc.up
0.00 fireblood,if=buff.ca_inc.up
0.00 ancestral_call,if=buff.ca_inc.up
0.00 use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
0.00 use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
0.00 use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
0.00 use_item,name=tidestorm_codex,if=equipped.165576
G 2.95 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams
0.00 purifying_blast
0.00 ripple_in_space
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
H 2.00 celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
0.00 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
I 3.12 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
0.00 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
J 64.35 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
K 2.63 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
L 2.85 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
M 14.67 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
N 11.34 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
O 12.80 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
P 81.89 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Q 101.04 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
R 0.33 sunfire

Sample Sequence

0123456789ACDJNMOHFGJQJQPQJQPQPJQPMQNQPQPJOJQKPPJQPPQPJQJQJQPQLPPJMPJOQPQJPQPJPQQMNJPQQJPOPJQPQJQPMQQPJNPJQPQQJPOQJMPQQQQJPNQJPQQQJMPQOQQQQQJGJQPJQLPPJMPQPJPQOQQPJPJPNMQJPQQQJPQQQPJOJQPQJMNPPQJPQQQPQQJMPHEFJOJNQPJQPQJQPQPMQPJQJQPJOQPNPJPQQMQQQQJJPPQJPQNOJMPQQGQPQQJPJQPQJQPJMNQPOJQPQQPQJPQJPQQQJPPQ

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask focusing iris 58.0/100: 58% astral_power
Pre precombat 1 food focusing iris 58.0/100: 58% astral_power
Pre precombat 2 augmentation focusing iris 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 9 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power battle_potion_of_intellect
0:00.000 default J starsurge Fluffy_Pillow 66.0/100: 66% astral_power focused_energy(3), battle_potion_of_intellect
0:01.222 default N moonfire Fluffy_Pillow 26.5/100: 27% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, focused_energy(3), battle_potion_of_intellect
0:02.135 default M sunfire Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, focused_energy(4), battle_potion_of_intellect
0:03.046 default O stellar_flare Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, focused_energy(5), battle_potion_of_intellect
0:03.952 default H celestial_alignment Fluffy_Pillow 42.5/100: 43% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, focused_energy(7), battle_potion_of_intellect
0:04.734 default F berserking Fluffy_Pillow 83.0/100: 83% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, focused_energy(8), battle_potion_of_intellect
0:04.734 default G use_items Fluffy_Pillow 83.0/100: 83% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, focused_energy(8), battle_potion_of_intellect
0:04.734 default J starsurge Fluffy_Pillow 83.0/100: 83% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, focused_energy(8), battle_potion_of_intellect, ignition_mages_fuse
0:05.488 default Q solar_wrath Fluffy_Pillow 43.5/100: 44% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), focused_energy(9), battle_potion_of_intellect, ignition_mages_fuse
0:06.242 default J starsurge Fluffy_Pillow 52.0/100: 52% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse
0:06.997 default Q solar_wrath Fluffy_Pillow 12.5/100: 13% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse
0:07.752 default P lunar_strike Fluffy_Pillow 21.0/100: 21% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse
0:08.564 default Q solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse
0:09.320 default J starsurge Fluffy_Pillow 42.0/100: 42% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(2)
0:10.072 default Q solar_wrath Fluffy_Pillow 2.5/100: 3% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(2)
0:10.827 default P lunar_strike Fluffy_Pillow 11.0/100: 11% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.606 default Q solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.361 default P lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), starlord(3), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.140 default J starsurge Fluffy_Pillow 48.5/100: 49% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment, starlord(3), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(3)
0:13.894 default Q solar_wrath Fluffy_Pillow 13.0/100: 13% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(3)
0:14.649 default P lunar_strike Fluffy_Pillow 21.5/100: 22% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.403 default M sunfire Fluffy_Pillow 38.0/100: 38% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.157 default Q solar_wrath Fluffy_Pillow 41.5/100: 42% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.912 default N moonfire Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(4)
0:17.667 default Q solar_wrath Fluffy_Pillow 53.5/100: 54% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(4)
0:18.421 default P lunar_strike Fluffy_Pillow 62.0/100: 62% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.216 default Q solar_wrath Fluffy_Pillow 74.5/100: 75% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, starlord(3), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.969 default P lunar_strike Fluffy_Pillow 83.0/100: 83% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, starlord(3), focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.903 default J starsurge Fluffy_Pillow 95.5/100: 96% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(5)
0:21.659 default O stellar_flare Fluffy_Pillow 60.0/100: 60% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(5)
0:22.413 default J starsurge Fluffy_Pillow 68.5/100: 69% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, focused_energy(10), battle_potion_of_intellect, ignition_mages_fuse(5)
0:23.169 default Q solar_wrath Fluffy_Pillow 29.0/100: 29% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), focused_energy(10), ignition_mages_fuse(5)
0:23.923 default K sunfire Fluffy_Pillow 41.5/100: 42% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), focused_energy(10), ignition_mages_fuse(5)
0:24.678 default P lunar_strike Fluffy_Pillow 45.0/100: 45% astral_power bloodlust, arcanic_pulsar(7), lunar_empowerment(3), solar_empowerment, starlord(2), focused_energy(10), ignition_mages_fuse(5)
0:25.586 default P lunar_strike Fluffy_Pillow 62.0/100: 62% astral_power bloodlust, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), focused_energy(10)
0:26.687 default J starsurge Fluffy_Pillow 74.5/100: 75% astral_power bloodlust, arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), focused_energy(10)
0:27.549 default Q solar_wrath Fluffy_Pillow 35.0/100: 35% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3), focused_energy(10)
0:28.304 default P lunar_strike Fluffy_Pillow 43.5/100: 44% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), focused_energy(10)
0:29.372 default P lunar_strike Fluffy_Pillow 56.5/100: 56% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), focused_energy(10)
0:30.441 default Q solar_wrath Fluffy_Pillow 69.0/100: 69% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment(2), starlord(3), focused_energy(10)
0:31.195 default P lunar_strike Fluffy_Pillow 77.5/100: 78% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), focused_energy(10)
0:32.263 default J starsurge Fluffy_Pillow 90.5/100: 91% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment, starlord(3), focused_energy(10)
0:33.104 default Q solar_wrath Fluffy_Pillow 63.0/100: 63% astral_power bloodlust, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), focused_energy(10)
0:33.859 default J starsurge Fluffy_Pillow 71.5/100: 72% astral_power bloodlust, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), focused_energy(10)
0:34.614 default Q solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), focused_energy(10)
0:35.369 default J starsurge Fluffy_Pillow 40.5/100: 41% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), focused_energy(10)
0:36.124 default Q solar_wrath Fluffy_Pillow 1.0/100: 1% astral_power bloodlust, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), focused_energy(10)
0:36.879 default P lunar_strike Fluffy_Pillow 9.5/100: 10% astral_power bloodlust, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), focused_energy(10)
0:37.807 default Q solar_wrath Fluffy_Pillow 22.0/100: 22% astral_power bloodlust, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), focused_energy(10)
0:38.562 default L moonfire Fluffy_Pillow 34.5/100: 35% astral_power bloodlust, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), starlord(3), focused_energy(10)
0:39.315 default P lunar_strike Fluffy_Pillow 38.0/100: 38% astral_power bloodlust, arcanic_pulsar(2), lunar_empowerment(2), starlord(3), focused_energy(10)
0:40.382 default P lunar_strike Fluffy_Pillow 54.5/100: 55% astral_power bloodlust, arcanic_pulsar(2), lunar_empowerment, starlord(3), focused_energy(10)
0:41.451 default J starsurge Fluffy_Pillow 67.5/100: 68% astral_power arcanic_pulsar(2), focused_energy(10)
0:42.640 default M sunfire Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord, focused_energy(10)
0:43.795 default P lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord, focused_energy(10)
0:45.263 default J starsurge Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord, focused_energy(10)
0:46.416 default O stellar_flare Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(2), focused_energy(10), conch_of_dark_whispers
0:47.538 default Q solar_wrath Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(2), focused_energy(10), conch_of_dark_whispers
0:48.490 default P lunar_strike Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), focused_energy(10), conch_of_dark_whispers
0:49.917 default Q solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(2), focused_energy(10), conch_of_dark_whispers
0:50.871 default J starsurge Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(4), solar_empowerment, starlord(2), focused_energy(10), conch_of_dark_whispers
0:51.992 default P lunar_strike Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), focused_energy(10), conch_of_dark_whispers
0:53.380 default Q solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), focused_energy(10), conch_of_dark_whispers
0:54.307 default P lunar_strike Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(3), focused_energy(10), conch_of_dark_whispers
0:55.693 default J starsurge Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), focused_energy(10), conch_of_dark_whispers
0:56.783 default P lunar_strike Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), focused_energy(10), conch_of_dark_whispers
0:58.171 default Q solar_wrath Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar(6), solar_empowerment(3), starlord(3), focused_energy(10), conch_of_dark_whispers
0:59.098 default Q solar_wrath Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), focused_energy(10), conch_of_dark_whispers
1:00.024 default M sunfire Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), focused_energy(10), conch_of_dark_whispers
1:01.115 default N moonfire Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), focused_energy(10)
1:02.205 default J starsurge Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(6), solar_empowerment, focused_energy(10)
1:03.393 default P lunar_strike Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord, focused_energy(10)
1:04.862 default Q solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord, focused_energy(10)
1:05.844 default Q solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(7), solar_empowerment, starlord, focused_energy(10)
1:06.824 default J starsurge Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(7), lunar_empowerment, starlord, focused_energy(10)
1:07.977 default P lunar_strike Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment, starlord(2), focused_energy(10)
1:09.404 default O stellar_flare Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(2), focused_energy(10)
1:10.525 default P lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(2), focused_energy(10)
1:11.950 default J starsurge Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(8), solar_empowerment, starlord(2), focused_energy(10)
1:13.071 default Q solar_wrath Fluffy_Pillow 17.5/100: 18% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), focused_energy(10)
1:13.877 default P lunar_strike Fluffy_Pillow 26.0/100: 26% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), focused_energy(10)
1:15.085 default Q solar_wrath Fluffy_Pillow 39.0/100: 39% astral_power celestial_alignment, solar_empowerment(2), starlord(3), focused_energy(10)
1:15.891 default J starsurge Fluffy_Pillow 47.5/100: 48% astral_power celestial_alignment, solar_empowerment, starlord(3), focused_energy(10)
1:16.837 default Q solar_wrath Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), focused_energy(10)
1:17.644 default P lunar_strike Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), focused_energy(10)
1:18.854 default M sunfire Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar, solar_empowerment, starlord(3), overwhelming_power(25), focused_energy(10)
1:19.855 default Q solar_wrath Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar, solar_empowerment, starlord(3), overwhelming_power(24), focused_energy(10)
1:20.710 default Q solar_wrath Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar, starlord(3), overwhelming_power(23), focused_energy(10)
1:21.716 default P lunar_strike Fluffy_Pillow 54.0/100: 54% astral_power arcanic_pulsar, lunar_empowerment, starlord(3), overwhelming_power(22), focused_energy(10)
1:23.003 default J starsurge Fluffy_Pillow 67.0/100: 67% astral_power arcanic_pulsar, solar_empowerment, overwhelming_power(20), focused_energy(10)
1:24.112 default N moonfire Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(19), focused_energy(10)
1:25.191 default P lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(18), focused_energy(10)
1:26.571 default J starsurge Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord, overwhelming_power(25), focused_energy(10)
1:27.629 default Q solar_wrath Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord(2), overwhelming_power(24), focused_energy(10)
1:28.506 default P lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(23), focused_energy(10)
1:29.825 default Q solar_wrath Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(2), overwhelming_power(22), focused_energy(10)
1:30.707 default Q solar_wrath Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(3), solar_empowerment, starlord(2), overwhelming_power(21), focused_energy(10)
1:31.595 default J starsurge Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(3), starlord(2), overwhelming_power(20), focused_energy(10)
1:32.640 default P lunar_strike Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(19), focused_energy(10)
1:33.938 default O stellar_flare Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(4), solar_empowerment, starlord(3), overwhelming_power(18), focused_energy(10), conch_of_dark_whispers
1:34.961 default Q solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(4), solar_empowerment, starlord(3), overwhelming_power(17), focused_energy(10), conch_of_dark_whispers
1:35.835 default J starsurge Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(4), starlord(3), overwhelming_power(16), focused_energy(10), conch_of_dark_whispers
1:36.866 default M sunfire Fluffy_Pillow 3.5/100: 4% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(15), focused_energy(10), conch_of_dark_whispers
1:37.898 default P lunar_strike Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(14), focused_energy(10), conch_of_dark_whispers
1:39.218 default Q solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), overwhelming_power(12), focused_energy(10), conch_of_dark_whispers
1:40.108 default Q solar_wrath Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(5), starlord(3), overwhelming_power(11), focused_energy(10), conch_of_dark_whispers
1:41.157 default Q solar_wrath Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(5), starlord(3), overwhelming_power(25), focused_energy(10), conch_of_dark_whispers
1:42.159 default Q solar_wrath Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(5), starlord(3), overwhelming_power(24), focused_energy(10), conch_of_dark_whispers
1:43.162 default J starsurge Fluffy_Pillow 54.5/100: 55% astral_power arcanic_pulsar(5), overwhelming_power(23), focused_energy(10), conch_of_dark_whispers
1:44.258 default P lunar_strike Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(22), focused_energy(10), conch_of_dark_whispers
1:45.618 default N moonfire Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(6), solar_empowerment, starlord, overwhelming_power(21), focused_energy(10), conch_of_dark_whispers
1:46.690 default Q solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(6), solar_empowerment, starlord, overwhelming_power(20), focused_energy(10), conch_of_dark_whispers
1:47.605 default J starsurge Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(6), starlord, overwhelming_power(19), focused_energy(10), conch_of_dark_whispers
1:48.687 default P lunar_strike Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(18), focused_energy(10)
1:50.028 default Q solar_wrath Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(7), solar_empowerment, starlord(2), overwhelming_power(16), focused_energy(10)
1:50.928 default Q solar_wrath Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(7), starlord(2), torrent_of_elements, overwhelming_power(16), focused_energy(10)
1:51.988 default Q solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(7), starlord(2), torrent_of_elements, overwhelming_power(15), focused_energy(10)
1:53.050 default J starsurge Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(7), starlord(2), torrent_of_elements, overwhelming_power(13), focused_energy(10)
1:54.120 default M sunfire Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(12), focused_energy(10)
1:55.165 default P lunar_strike Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(11), focused_energy(10)
1:56.500 default Q solar_wrath Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(10), focused_energy(10)
1:57.394 default O stellar_flare Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(8), starlord(3), torrent_of_elements, overwhelming_power(9), focused_energy(10)
1:58.449 default Q solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(8), starlord(3), torrent_of_elements, overwhelming_power(8), focused_energy(10)
1:59.507 default Q solar_wrath Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(8), starlord(3), torrent_of_elements, overwhelming_power(7), focused_energy(10)
2:00.571 default Q solar_wrath Fluffy_Pillow 56.0/100: 56% astral_power arcanic_pulsar(8), starlord(3), torrent_of_elements, overwhelming_power(6), focused_energy(10)
2:01.638 default Q solar_wrath Fluffy_Pillow 65.0/100: 65% astral_power arcanic_pulsar(8), starlord(3), torrent_of_elements, overwhelming_power(5), focused_energy(10)
2:02.709 default Q solar_wrath Fluffy_Pillow 73.5/100: 74% astral_power arcanic_pulsar(8), starlord(3), torrent_of_elements, overwhelming_power(4), focused_energy(10)
2:03.782 default J starsurge Fluffy_Pillow 82.5/100: 83% astral_power arcanic_pulsar(8), torrent_of_elements, overwhelming_power(3), focused_energy(10)
2:04.957 default G use_items Fluffy_Pillow 55.0/100: 55% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(2), focused_energy(10)
2:04.957 default J starsurge Fluffy_Pillow 55.0/100: 55% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(2), focused_energy(10), ignition_mages_fuse
2:05.912 default Q solar_wrath Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power, focused_energy(10), ignition_mages_fuse
2:06.703 default P lunar_strike Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), focused_energy(10), ignition_mages_fuse
2:07.893 default J starsurge Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), focused_energy(10), ignition_mages_fuse
2:08.828 default Q solar_wrath Fluffy_Pillow 1.5/100: 2% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse
2:09.602 default L moonfire Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(2)
2:10.476 default P lunar_strike Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(2)
2:11.756 default P lunar_strike Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(2)
2:13.037 default J starsurge Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(3)
2:14.005 default M sunfire Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(3)
2:14.973 default P lunar_strike Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(3)
2:16.203 default Q solar_wrath Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(3)
2:17.025 default P lunar_strike Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord(3), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(4)
2:18.214 default J starsurge Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(4)
2:19.145 default P lunar_strike Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(4)
2:20.332 default Q solar_wrath Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(4)
2:21.126 default O stellar_flare Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(4), solar_empowerment, starlord(3), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(5)
2:22.027 default Q solar_wrath Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(4), solar_empowerment, starlord(3), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(5)
2:22.792 default Q solar_wrath Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar(4), starlord(3), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(5)
2:23.691 default P lunar_strike Fluffy_Pillow 57.5/100: 57% astral_power arcanic_pulsar(4), lunar_empowerment, starlord(3), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(5)
2:24.836 default J starsurge Fluffy_Pillow 70.5/100: 71% astral_power arcanic_pulsar(4), focused_energy(10), ignition_mages_fuse(5)
2:25.815 default P lunar_strike Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord, focused_energy(10)
2:27.284 default J starsurge Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(5), solar_empowerment, starlord, focused_energy(10)
2:28.438 default P lunar_strike Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), focused_energy(10)
2:29.863 default N moonfire Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(2), focused_energy(10)
2:30.984 default M sunfire Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(2), focused_energy(10)
2:32.104 default Q solar_wrath Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(2), focused_energy(10)
2:33.058 default J starsurge Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(6), solar_empowerment, starlord(2), focused_energy(10)
2:34.180 default P lunar_strike Fluffy_Pillow 2.5/100: 3% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), focused_energy(10)
2:35.569 default Q solar_wrath Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), focused_energy(10)
2:36.496 default Q solar_wrath Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), focused_energy(10)
2:37.423 default Q solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(7), starlord(3), focused_energy(10)
2:38.513 default J starsurge Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(7), starlord(3), focused_energy(10)
2:39.603 default P lunar_strike Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), focused_energy(10)
2:40.990 default Q solar_wrath Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), focused_energy(10)
2:41.918 default Q solar_wrath Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(8), starlord(3), focused_energy(10)
2:43.006 default Q solar_wrath Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(8), starlord(3), focused_energy(10)
2:44.096 default P lunar_strike Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar(8), lunar_empowerment, starlord(3), focused_energy(10)
2:45.485 default J starsurge Fluffy_Pillow 62.0/100: 62% astral_power arcanic_pulsar(8), solar_empowerment, focused_energy(10)
2:46.673 default O stellar_flare Fluffy_Pillow 35.0/100: 35% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord, focused_energy(10)
2:47.677 default J starsurge Fluffy_Pillow 43.5/100: 44% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord, focused_energy(10)
2:48.681 default Q solar_wrath Fluffy_Pillow 4.0/100: 4% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(2), focused_energy(10)
2:49.509 default P lunar_strike Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), focused_energy(10)
2:50.749 default Q solar_wrath Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), focused_energy(10)
2:51.576 default J starsurge Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(25), focused_energy(10)
2:52.471 default M sunfire Fluffy_Pillow 2.5/100: 3% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(24), focused_energy(10)
2:53.474 default N moonfire Fluffy_Pillow 6.5/100: 7% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(23), focused_energy(10)
2:54.481 default P lunar_strike Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(22), focused_energy(10)
2:55.769 default P lunar_strike Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(21), focused_energy(10)
2:57.059 default Q solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3), overwhelming_power(19), focused_energy(10)
2:57.926 default J starsurge Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), overwhelming_power(19), focused_energy(10)
2:58.945 default P lunar_strike Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(18), focused_energy(10)
3:00.248 default Q solar_wrath Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), overwhelming_power(16), focused_energy(10)
3:01.124 default Q solar_wrath Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), overwhelming_power(15), focused_energy(10)
3:02.003 default Q solar_wrath Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(3), starlord(3), overwhelming_power(14), focused_energy(10)
3:03.039 default P lunar_strike Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(3), lunar_empowerment, starlord(3), overwhelming_power(13), focused_energy(10)
3:04.366 default Q solar_wrath Fluffy_Pillow 56.5/100: 56% astral_power arcanic_pulsar(3), starlord(3), overwhelming_power(12), focused_energy(10)
3:05.411 default Q solar_wrath Fluffy_Pillow 65.5/100: 66% astral_power arcanic_pulsar(3), starlord(3), overwhelming_power(11), focused_energy(10)
3:06.461 default J starsurge Fluffy_Pillow 74.0/100: 74% astral_power arcanic_pulsar(3), overwhelming_power(10), focused_energy(10)
3:07.608 default M sunfire Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(9), focused_energy(10)
3:08.726 default P lunar_strike Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(8), focused_energy(10)
3:10.154 default H celestial_alignment Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(4), celestial_alignment, solar_empowerment, starlord, overwhelming_power(6), focused_energy(10)
3:11.137 default E potion Fluffy_Pillow 92.0/100: 92% astral_power arcanic_pulsar(4), celestial_alignment, solar_empowerment, starlord, overwhelming_power(5), focused_energy(10)
3:11.137 default F berserking Fluffy_Pillow 92.0/100: 92% astral_power arcanic_pulsar(4), celestial_alignment, solar_empowerment, starlord, overwhelming_power(5), focused_energy(10), battle_potion_of_intellect
3:11.137 default J starsurge Fluffy_Pillow 92.0/100: 92% astral_power berserking, arcanic_pulsar(4), celestial_alignment, solar_empowerment, starlord, overwhelming_power(5), focused_energy(10), battle_potion_of_intellect
3:12.034 default O stellar_flare Fluffy_Pillow 53.0/100: 53% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(4), focused_energy(10), battle_potion_of_intellect
3:12.907 default J starsurge Fluffy_Pillow 61.5/100: 62% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(4), focused_energy(10), battle_potion_of_intellect
3:13.782 default N moonfire Fluffy_Pillow 22.0/100: 22% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(3), focused_energy(10), battle_potion_of_intellect
3:14.635 default Q solar_wrath Fluffy_Pillow 25.5/100: 26% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(2), focused_energy(10), battle_potion_of_intellect
3:15.390 default P lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power, focused_energy(10), battle_potion_of_intellect
3:16.483 default J starsurge Fluffy_Pillow 46.5/100: 47% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), focused_energy(10), battle_potion_of_intellect
3:17.344 default Q solar_wrath Fluffy_Pillow 7.5/100: 8% astral_power berserking, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), focused_energy(10), battle_potion_of_intellect
3:18.099 default P lunar_strike Fluffy_Pillow 16.0/100: 16% astral_power berserking, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), focused_energy(10), battle_potion_of_intellect
3:19.197 default Q solar_wrath Fluffy_Pillow 28.5/100: 28% astral_power berserking, arcanic_pulsar(7), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), focused_energy(10), battle_potion_of_intellect
3:19.949 default J starsurge Fluffy_Pillow 41.0/100: 41% astral_power berserking, arcanic_pulsar(7), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), focused_energy(10), battle_potion_of_intellect
3:20.812 default Q solar_wrath Fluffy_Pillow 1.5/100: 2% astral_power berserking, arcanic_pulsar(8), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), focused_energy(10), battle_potion_of_intellect
3:21.567 default P lunar_strike Fluffy_Pillow 10.0/100: 10% astral_power berserking, arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), focused_energy(10), battle_potion_of_intellect
3:22.665 default Q solar_wrath Fluffy_Pillow 23.0/100: 23% astral_power berserking, arcanic_pulsar(8), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), focused_energy(10), battle_potion_of_intellect
3:23.419 default P lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), focused_energy(10), battle_potion_of_intellect
3:24.626 default M sunfire Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), focused_energy(10), battle_potion_of_intellect
3:25.573 default Q solar_wrath Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), focused_energy(10), battle_potion_of_intellect
3:26.380 default P lunar_strike Fluffy_Pillow 60.5/100: 61% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment, starlord(3), focused_energy(10), battle_potion_of_intellect
3:27.589 default J starsurge Fluffy_Pillow 73.0/100: 73% astral_power arcanic_pulsar(8), celestial_alignment, focused_energy(10), battle_potion_of_intellect
3:28.623 default Q solar_wrath Fluffy_Pillow 46.0/100: 46% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, focused_energy(10), battle_potion_of_intellect
3:29.476 default J starsurge Fluffy_Pillow 54.5/100: 55% astral_power celestial_alignment, lunar_empowerment, starlord, focused_energy(10), battle_potion_of_intellect
3:30.479 default Q solar_wrath Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), focused_energy(10), battle_potion_of_intellect
3:31.310 default P lunar_strike Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), focused_energy(10), battle_potion_of_intellect
3:32.551 default J starsurge Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(2), focused_energy(10), battle_potion_of_intellect
3:33.525 default O stellar_flare Fluffy_Pillow 1.0/100: 1% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, focused_energy(10), battle_potion_of_intellect
3:34.475 default Q solar_wrath Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, focused_energy(10), battle_potion_of_intellect
3:35.283 default P lunar_strike Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(25), focused_energy(10), battle_potion_of_intellect
3:36.390 default N moonfire Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(2), lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(24), focused_energy(10)
3:37.395 default P lunar_strike Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(2), lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(23), focused_energy(10)
3:38.678 default J starsurge Fluffy_Pillow 55.5/100: 56% astral_power arcanic_pulsar(2), starlord(3), torrent_of_elements, overwhelming_power(22), focused_energy(10)
3:39.689 default P lunar_strike Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(21), focused_energy(10)
3:40.979 default Q solar_wrath Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(20), focused_energy(10)
3:41.844 default Q solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(3), starlord(3), torrent_of_elements, overwhelming_power(19), focused_energy(10)
3:42.865 default M sunfire Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(3), starlord(3), torrent_of_elements, overwhelming_power(18), focused_energy(10)
3:43.888 default Q solar_wrath Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(3), starlord(3), torrent_of_elements, overwhelming_power(17), focused_energy(10)
3:44.914 default Q solar_wrath Fluffy_Pillow 58.5/100: 59% astral_power arcanic_pulsar(3), starlord(3), torrent_of_elements, overwhelming_power(16), focused_energy(10)
3:45.944 default Q solar_wrath Fluffy_Pillow 67.5/100: 68% astral_power arcanic_pulsar(3), starlord(3), torrent_of_elements, overwhelming_power(15), focused_energy(10)
3:46.978 default Q solar_wrath Fluffy_Pillow 76.0/100: 76% astral_power arcanic_pulsar(3), starlord(3), torrent_of_elements, overwhelming_power(14), focused_energy(10)
3:48.014 default J starsurge Fluffy_Pillow 85.0/100: 85% astral_power arcanic_pulsar(3), torrent_of_elements, overwhelming_power(12), focused_energy(10)
3:49.154 default J starsurge Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(11), focused_energy(10)
3:50.266 default P lunar_strike Fluffy_Pillow 6.5/100: 7% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(10), focused_energy(10)
3:51.643 default P lunar_strike Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(9), focused_energy(10)
3:53.026 default Q solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(2), overwhelming_power(7), focused_energy(10)
3:53.956 default J starsurge Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(5), solar_empowerment, starlord(2), overwhelming_power(7), focused_energy(10)
3:55.049 default P lunar_strike Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(5), focused_energy(10)
3:56.414 default Q solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), overwhelming_power(4), focused_energy(10)
3:57.327 default N moonfire Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), overwhelming_power(3), focused_energy(10)
3:58.405 default O stellar_flare Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), overwhelming_power(2), focused_energy(10)
3:59.486 default J starsurge Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), overwhelming_power, focused_energy(10)
4:00.570 default M sunfire Fluffy_Pillow 4.0/100: 4% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), focused_energy(10)
4:01.661 default P lunar_strike Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), focused_energy(10)
4:03.048 default Q solar_wrath Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(7), solar_empowerment(3), starlord(3), focused_energy(10)
4:03.976 default Q solar_wrath Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), overwhelming_power(25), focused_energy(10)
4:04.827 default G use_items Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), overwhelming_power(24), focused_energy(10), conch_of_dark_whispers
4:04.827 default Q solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), overwhelming_power(24), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse
4:05.648 default P lunar_strike Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(7), lunar_empowerment, starlord(3), overwhelming_power(23), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse
4:06.882 default Q solar_wrath Fluffy_Pillow 59.5/100: 60% astral_power arcanic_pulsar(7), starlord(3), overwhelming_power(22), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse
4:07.854 default Q solar_wrath Fluffy_Pillow 68.0/100: 68% astral_power arcanic_pulsar(7), starlord(3), overwhelming_power(21), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse
4:08.830 default J starsurge Fluffy_Pillow 76.5/100: 77% astral_power arcanic_pulsar(7), overwhelming_power(20), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(2)
4:09.858 default P lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(19), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(2)
4:11.131 default J starsurge Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord, overwhelming_power(17), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(2)
4:12.138 default Q solar_wrath Fluffy_Pillow 23.0/100: 23% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(2), overwhelming_power(16), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(2)
4:12.893 default P lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(16), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(3)
4:13.941 default Q solar_wrath Fluffy_Pillow 44.0/100: 44% astral_power celestial_alignment, solar_empowerment(3), starlord(2), overwhelming_power(15), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(3)
4:14.695 default J starsurge Fluffy_Pillow 56.5/100: 56% astral_power celestial_alignment, solar_empowerment(2), starlord(2), overwhelming_power(14), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(3)
4:15.524 default Q solar_wrath Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(13), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(3)
4:16.281 default P lunar_strike Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(12), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(3)
4:17.313 default J starsurge Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar, celestial_alignment, solar_empowerment(2), starlord(3), overwhelming_power(11), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(4)
4:18.097 default M sunfire Fluffy_Pillow 3.0/100: 3% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(10), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(4)
4:19.002 default N moonfire Fluffy_Pillow 6.5/100: 7% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(9), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(4)
4:19.910 default Q solar_wrath Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(9), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(4)
4:20.682 default P lunar_strike Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(8), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(4)
4:21.842 default O stellar_flare Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3), overwhelming_power(7), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(5)
4:22.723 default J starsurge Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3), overwhelming_power(6), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(5)
4:23.605 default Q solar_wrath Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(5), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(5)
4:24.360 default P lunar_strike Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(4), focused_energy(10), conch_of_dark_whispers, ignition_mages_fuse(5)
4:25.491 default Q solar_wrath Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), overwhelming_power(3), focused_energy(10), conch_of_dark_whispers
4:26.408 default Q solar_wrath Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), overwhelming_power(2), focused_energy(10), conch_of_dark_whispers
4:27.328 default P lunar_strike Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(3), lunar_empowerment, starlord(3), overwhelming_power, focused_energy(10), conch_of_dark_whispers
4:28.711 default Q solar_wrath Fluffy_Pillow 56.0/100: 56% astral_power arcanic_pulsar(3), starlord(3), focused_energy(10), conch_of_dark_whispers
4:29.801 default J starsurge Fluffy_Pillow 64.5/100: 65% astral_power arcanic_pulsar(3), focused_energy(10), conch_of_dark_whispers
4:30.988 default P lunar_strike Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord, focused_energy(10), conch_of_dark_whispers
4:32.456 default Q solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(4), solar_empowerment, starlord, focused_energy(10), conch_of_dark_whispers
4:33.435 default J starsurge Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(4), starlord, focused_energy(10), conch_of_dark_whispers
4:34.589 default P lunar_strike Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(2), focused_energy(10), conch_of_dark_whispers
4:36.015 default Q solar_wrath Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(5), solar_empowerment, starlord(2), focused_energy(10), conch_of_dark_whispers
4:36.967 default Q solar_wrath Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(5), starlord(2), focused_energy(10)
4:38.087 default Q solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(5), starlord(2), focused_energy(10)
4:39.206 default J starsurge Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(5), lunar_empowerment, starlord(2), focused_energy(10)
4:40.327 default P lunar_strike Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment, starlord(3), focused_energy(10)
4:41.714 default P lunar_strike Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), focused_energy(10)
4:43.102 default Q solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(6), solar_empowerment(3), starlord(3), focused_energy(10)

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 16238 14762 13761
Intellect 1467 -3 13346 11714 9693 (6045)
Spirit 0 0 0 0 0
Health 324760 295240 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 13346 11714 0
Crit 15.68% 15.68% 769
Haste 21.51% 21.51% 1463
Damage / Heal Versatility 4.81% 4.81% 409
ManaReg per Second 2378 640 0
Attack Power 13880 12183 0
Mastery 55.20% 55.20% 2005
Armor 2962 2962 2962
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 447.00
Local Head Hood of the Slithering Loa
ilevel: 450, stats: { 407 Armor, +1145 AgiInt, +2255 Sta }
Local Neck Heart of Azeroth
ilevel: 463, stats: { +325 Haste, +325 Crit, +325 Mastery, +719 Sta, +382 StrAgiInt }
Local Shoulders Gorak Tul's Mantle
ilevel: 450, stats: { 376 Armor, +859 AgiInt, +1691 Sta }
Local Chest Spymaster's Wrap
ilevel: 450, stats: { 501 Armor, +1145 AgiInt, +2255 Sta }
Local Waist Beloved Monarch's Waistwrap
ilevel: 445, stats: { 271 Armor, +431 AgiInt, +789 Sta, +147 Mastery, +82 Crit }
Local Legs Leggings of the Stormborn
ilevel: 445, stats: { 422 Armor, +575 AgiInt, +1053 Sta, +179 Vers, +126 Crit }
Local Feet Ancient Tempest Striders
ilevel: 445, stats: { 331 Armor, +431 AgiInt, +789 Sta, +134 Mastery, +95 Haste }
Local Wrists Tideblood Bracers
ilevel: 445, stats: { 211 Armor, +323 AgiInt, +592 Sta, +105 Haste, +66 Crit }
Local Hands Gloves of Incomparable Beauty
ilevel: 445, stats: { 301 Armor, +431 AgiInt, +789 Sta, +134 Haste, +95 Mastery }
Local Finger1 Boralus Noble's Seal
ilevel: 445, stats: { +592 Sta, +369 Mastery, +169 Haste }, enchant: { +60 Haste }
Local Finger2 Cursed Lover's Ring
ilevel: 445, stats: { +592 Sta, +307 Haste, +230 Vers }, enchant: { +60 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 445, stats: { +546 Int }
Local Trinket2 Conch of Dark Whispers
ilevel: 445, stats: { +546 Int }
Local Back Cloak of Ill Tidings
ilevel: 445, stats: { 142 Armor, +323 StrAgiInt, +592 Sta, +110 Mastery, +61 Crit }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 445, weapon: { 661 - 896, 3.6 }, stats: { +575 Int, +1053 Sta, +109 Haste, +109 Crit, +109 Mastery, +1981 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="focusing iris"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
talents=1000231
azerite_override=lifespeed:450/heed_my_call:450/overwhelming_power:450/streaking_stars:450/streaking_stars:450/streaking_stars:450/arcanic_pulsar:450/loyal_to_the_end:450/loyal_to_the_end:450

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6&active_enemies=1
actions+=/potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
actions+=/blood_fury,if=buff.ca_inc.up
actions+=/berserking,if=buff.ca_inc.up
actions+=/arcane_torrent,if=buff.ca_inc.up
actions+=/lights_judgment,if=buff.ca_inc.up
actions+=/fireblood,if=buff.ca_inc.up
actions+=/ancestral_call,if=buff.ca_inc.up
actions+=/use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
actions+=/use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
actions+=/use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
actions+=/celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=hood_of_the_slithering_loa,id=159318,ilevel=450
neck=heart_of_azeroth,id=158075,ilevel=463
shoulders=gorak_tuls_mantle,id=159339,ilevel=450
back=cloak_of_ill_tidings,id=168391,ilevel=445
chest=spymasters_wrap,id=155860,ilevel=450
wrists=tideblood_bracers,id=168377,ilevel=445
hands=gloves_of_incomparable_beauty,id=168887,ilevel=445
waist=beloved_monarchs_waistwrap,id=168871,ilevel=445
legs=leggings_of_the_stormborn,id=168378,ilevel=445
feet=ancient_tempest_striders,id=168380,ilevel=445
finger1=boralus_nobles_seal,id=168889,ilevel=445,enchant=60haste
finger2=cursed_lovers_ring,id=168891,ilevel=445,enchant=60haste
trinket1=ignition_mages_fuse,id=159615,ilevel=445
trinket2=conch_of_dark_whispers,id=159620,ilevel=445
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=445,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=447.20
# gear_stamina=13761
# gear_intellect=9693
# gear_crit_rating=769
# gear_haste_rating=1364
# gear_mastery_rating=1289
# gear_versatility_rating=409
# gear_armor=2962

lucid dreams : 43233 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
43232.6 43232.6 21.6 / 0.050% 5284.6 / 12.2% 4443.2
RPS Out RPS In Primary Resource Waiting APM Active Skill
9.7 9.6 Astral Power 0.00% 59.6 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Stellar Flare (Balance Druid)
  • 100: Shooting Stars (Balance Druid)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
lucid dreams 43233
Heed My Call 303 (432) 0.7% (1.0%) 8.3 32.80sec 15650 0 Direct 8.3 9229 18458 10958 18.7%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.27 8.27 0.00 0.00 0.0000 0.0000 90596.97 90596.97 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.72 81.26% 9228.97 8921 10228 9229.13 0 10228 62004 62004 0.00
crit 1.55 18.74% 18458.47 17842 20456 14570.40 0 20456 28593 28593 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 130 0.3% 8.3 32.80sec 4692 0 Direct 8.3 3955 7912 4692 18.6%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.27 8.27 0.00 0.00 0.0000 0.0000 38792.10 38792.10 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.73 81.37% 3955.15 3823 4384 3954.40 0 4384 26608 26608 0.00
crit 1.54 18.63% 7911.84 7646 8767 6251.53 0 8767 12184 12184 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 5867 13.6% 76.9 3.79sec 22840 17523 Direct 76.9 19250 38493 22840 18.7%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 76.92 76.92 0.00 0.00 1.3034 0.0000 1756930.32 1756930.32 0.00 17523.22 17523.22
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 62.57 81.35% 19250.31 10135 25236 19258.88 18561 20338 1204566 1204566 0.00
crit 14.35 18.65% 38492.54 23310 50471 38508.11 35514 44951 552364 552364 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 2916 6.7% 14.2 21.23sec 61497 60790 Direct 14.2 3288 6575 3903 18.7%  
Periodic 224.4 3069 6135 3641 18.7% 99.2%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.19 14.19 224.40 224.40 1.0117 1.3248 872455.98 872455.98 0.00 2799.53 60789.85
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.53 81.29% 3288.19 2981 4237 3289.45 3026 3635 37921 37921 0.00
crit 2.65 18.71% 6575.18 5963 8474 6198.73 0 8474 17454 17454 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 182.5 81.33% 3068.66 2 3945 3070.12 2970 3225 560068 560068 0.00
crit 41.9 18.67% 6135.01 15 7890 6137.70 5747 6659 257013 257013 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Shooting Stars 938 2.2% 44.9 6.49sec 6258 0 Direct 44.9 5274 10540 6258 18.7%  

Stats details: shooting_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.86 44.86 0.00 0.00 0.0000 0.0000 280740.80 280740.80 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.49 81.33% 5274.28 4769 6778 5276.47 4935 5795 192442 192442 0.00
crit 8.38 18.67% 10539.99 9539 13556 10539.02 0 13060 88298 88298 0.00
 
 

Action details: shooting_stars

Static Values
  • id:202497
  • school:astral
  • resource:none
  • range:50000.0
  • travel_speed:0.8000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating ${$202497m2/10} Astral Power.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.360000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Solar Wrath 3003 (5138) 7.0% (11.9%) 85.0 3.45sec 18077 20503 Direct 85.7 8838 17675 10486 18.6%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 85.05 85.70 0.00 0.00 0.8817 0.0000 898591.82 898591.82 0.00 20502.97 20502.97
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 69.72 81.35% 8837.70 7949 11297 8842.55 8468 9311 616151 616151 0.00
crit 15.98 18.65% 17674.97 15898 22594 17684.28 15898 20842 282441 282441 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (solar_empowerment) 2134 4.9% 81.0 3.61sec 7890 0 Direct 81.0 7890 0 7890 0.0%  

Stats details: solar_empowerment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 80.97 80.97 0.00 0.00 0.0000 0.0000 638864.07 638864.07 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 80.97 100.00% 7889.73 5962 16945 7893.59 6775 9235 638864 638864 0.00
 
 

Action details: solar_empowerment

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:12427.94
  • base_dd_max:12427.94
  • base_dd_mult:1.00
 
Starsurge 16339 37.8% 72.7 4.17sec 67189 65360 Direct 72.4 56906 113701 67477 18.6%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 72.73 72.42 0.00 0.00 1.0280 0.0000 4886663.97 4886663.97 0.00 65360.32 65360.32
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 58.94 81.39% 56906.24 51347 72557 56927.98 54621 59898 3354099 3354099 0.00
crit 13.48 18.61% 113700.78 102695 145115 113742.04 102695 129739 1532565 1532565 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Stellar Flare 1894 4.4% 12.8 23.58sec 44382 43472 Direct 12.8 2816 5630 3340 18.6%  
Periodic 222.1 1989 3976 2360 18.7% 98.4%

Stats details: stellar_flare

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.77 12.77 222.10 222.10 1.0209 1.3272 566871.25 566871.25 0.00 1841.64 43471.72
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.39 81.39% 2816.05 2570 3653 2817.07 2592 3135 29273 29273 0.00
crit 2.38 18.61% 5630.24 5140 7306 5206.04 0 7306 13386 13386 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 180.7 81.34% 1989.50 3 2557 1990.45 1924 2091 359411 359411 0.00
crit 41.4 18.66% 3976.49 27 5114 3978.22 3710 4369 164801 164801 0.00
 
 

Action details: stellar_flare

Static Values
  • id:202347
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
Spelldata
  • id:202347
  • name:Stellar Flare
  • school:astral
  • tooltip:Suffering $w2 Astral damage every $t2 sec.
  • description:Burns the target for {$s1=0} Astral damage, and then an additional $o2 damage over {$d=24 seconds}. |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.125000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.087500
  • base_td:0.00
  • base_td_mult:0.82
  • dot_duration:24.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Streaking Star (s) 6472 14.9% 97.8 2.88sec 19703 0 Direct 97.8 16615 33235 19703 18.6%  

Stats details: streaking_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 97.81 97.81 0.00 0.00 0.0000 0.0000 1927120.51 1927120.51 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 79.63 81.42% 16614.60 16021 18369 16614.40 16040 17681 1323002 1323002 0.00
crit 18.18 18.58% 33234.98 32042 36737 33234.10 32042 35624 604119 604119 0.00
 
 

Action details: streaking_stars

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 3237 7.5% 17.4 17.15sec 55537 54906 Direct 17.4 4568 9136 5423 18.7%  
Periodic 223.6 3294 6585 3909 18.7% 98.9%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.44 17.44 223.62 223.62 1.0115 1.3253 968650.03 968650.03 0.00 3084.81 54905.91
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.18 81.28% 4568.16 4112 5844 4569.50 4242 4966 64762 64762 0.00
crit 3.26 18.72% 9135.75 8225 11689 8856.12 0 11689 29824 29824 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 181.9 81.33% 3294.28 5 4237 3295.82 3192 3472 599104 599104 0.00
crit 41.8 18.67% 6584.85 17 8474 6587.32 6118 7224 274960 274960 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Simple Action Stats Execute Interval
lucid dreams
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:lucid dreams
  • harmful:false
  • if_expr:
 
Berserking 2.0 182.08sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.0 184.35sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.8597 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:(buff.memory_of_lucid_dreams.up|(cooldown.memory_of_lucid_dreams.remains>20&astral_power>=40&ap_check))&!buff.ca_inc.up&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:251837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:lucid dreams
  • harmful:false
  • if_expr:
 
Bountiful Captain's Feast (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:259410
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:lucid dreams
  • harmful:false
  • if_expr:
 
Memory of Lucid Dreams 2.9 123.01sec

Stats details: memory_of_lucid_dreams

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.87 0.00 0.00 0.00 1.0049 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: memory_of_lucid_dreams

Static Values
  • id:298357
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:dot.sunfire.remains>10&dot.moonfire.remains>10&(astral_power<40|cooldown.ca_inc.remains>30)&dot.stellar_flare.remains>10&!buff.ca_inc.up
Spelldata
  • id:298357
  • name:Memory of Lucid Dreams
  • school:physical
  • tooltip:$?a300120[Shield of the Righteous recharge rate increased by ${{$300120s1=50}*-2}%]?a303412[Frostbolt and Flurry will generate an additional Icicle]?a303399[Fire Blast recharge rate increased by ${{$303399s1=50}*-2}%][{$@spelldesc304633=$?a137033[Insanity]?(a137032|a137031|a137021|a137020|a137019|a137012|a137029|a137028|a137024|a137039)[Mana]?a137027[Holy Power]?(a137050|a137049|a137048|a137010)[Rage]?(a137017|a137015|a137016)[Focus]?(a137011|a137025|a137023|a137037|a137036|a137035)[Energy]?a212613[Pain]?a212612[Fury]?(a137046|a137044|a137043)[Soul Shard]?(a137008|a137007|a137006)[Rune]?(a137041|a137040)[Maelstrom]?a137013[Astral Power][]} generation increased by {$s1=100}%].$?$w2>0[ Leech increased by $w2.][]
  • description:Clear your mind and attune yourself with the Heart of Azeroth, $?a137028[increasing your Shield of the Righteous recharge rate by ${{$300120s1=50}*-2}%]?a137020[causing Frostbolt and Flurry to generate an additional Icicle]?a137019[increasing your Fire Blast recharge rate by ${{$303399s1=50}*-2}%][increasing your {$@spelldesc304633=$?a137033[Insanity]?(a137032|a137031|a137021|a137020|a137019|a137012|a137029|a137028|a137024|a137039)[Mana]?a137027[Holy Power]?(a137050|a137049|a137048|a137010)[Rage]?(a137017|a137015|a137016)[Focus]?(a137011|a137025|a137023|a137037|a137036|a137035)[Energy]?a212613[Pain]?a212612[Fury]?(a137046|a137044|a137043)[Soul Shard]?(a137008|a137007|a137006)[Rune]?(a137041|a137040)[Maelstrom]?a137013[Astral Power][]} generation rate by {$s1=100}%]$?a298377[ and ][]$?a137020&a298377[increases ][]$?a298377[your Leech by {$298268s6=224}][] for {$d=12 seconds}.
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Battle Potion of Intellect (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:279151
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 8.5 63.9 37.4sec 4.2sec 92.41% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:10.60%
  • arcanic_pulsar_2:12.10%
  • arcanic_pulsar_3:11.96%
  • arcanic_pulsar_4:11.24%
  • arcanic_pulsar_5:10.95%
  • arcanic_pulsar_6:11.56%
  • arcanic_pulsar_7:11.84%
  • arcanic_pulsar_8:12.16%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 191.2sec 0.0sec 16.24% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.24%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Battle-Scarred Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Berserking 2.0 0.0 182.1sec 182.1sec 8.12% 8.15% 0.0(0.0) 2.0

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast) 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Celestial Alignment 8.4 0.0 37.1sec 37.1sec 28.45% 35.81% 0.0(0.0) 8.2

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:28.45%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Conch of Dark Whispers 4.3 1.1 61.1sec 45.7sec 23.60% 0.00% 1.1(1.1) 4.0

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_conch_of_dark_whispers
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Conch of Dark Whispers

Stat Buff details

  • stat:crit_rating
  • amount:913.59

Stack Uptimes

  • conch_of_dark_whispers_1:23.60%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271071
  • name:Conch of Dark Whispers
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc271072=Your spells have a chance to grant you {$271071s1=649} Critical Strike for {$271071d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Ignition Mage's Fuse 2.9 0.0 120.4sec 120.4sec 19.10% 0.00% 2.8(2.8) 2.8

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:366.08

Stack Uptimes

  • ignition_mages_fuse_1:3.93%
  • ignition_mages_fuse_2:3.88%
  • ignition_mages_fuse_3:3.82%
  • ignition_mages_fuse_4:3.77%
  • ignition_mages_fuse_5:3.71%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lucid Dreams 8.4 2.5 34.4sec 25.8sec 25.42% 0.00% 2.5(2.5) 8.1

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_lucid_dreams
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:versatility_rating
  • amount:376.75

Stack Uptimes

  • lucid_dreams_1:25.42%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:298343
  • name:Lucid Dreams
  • tooltip:Versatility increased by $w1.
  • description:{$@spelldesc298339=When Lucid Dreams $?!a137020[refunds ][]$?a137028[part of a Shield of the Righteous charge]?a137019[part of a charge of Fire Blast]?a137020[generates an icicle][{$@spelldesc298373=$?a137033[Insanity]?(a137032|a137031|a137021|a137020|a137019|a137012|a137029|a137028|a137024|a137039)[Mana]?a137027[Holy Power]?(a137050|a137049|a137048|a137010)[Rage]?(a137017|a137015|a137016)[Focus]?(a137011|a137025|a137023|a137037|a137036|a137035)[Energy]?a212613[Pain]?a212612[Fury]?(a137046|a137044|a137043)[Soul Shard]?(a137008|a137007|a137006)[Runes]?(a137041|a137040)[Maelstrom]?a137013[Astral Power][]}], gain {$s1=0} Versatility for {$298343d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Lunar Empowerment 16.5 73.5 17.9sec 3.4sec 93.60% 99.99% 10.9(10.9) 0.0

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:20.01%
  • lunar_empowerment_2:42.79%
  • lunar_empowerment_3:30.80%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Memory of Lucid Dreams 2.9 0.0 123.1sec 123.1sec 14.23% 16.60% 0.0(0.0) 2.8

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_memory_of_lucid_dreams
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:leech_rating
  • amount:0.00

Stack Uptimes

  • memory_of_lucid_dreams_1:14.23%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:298357
  • name:Memory of Lucid Dreams
  • tooltip:$?a300120[Shield of the Righteous recharge rate increased by ${{$300120s1=50}*-2}%]?a303412[Frostbolt and Flurry will generate an additional Icicle]?a303399[Fire Blast recharge rate increased by ${{$303399s1=50}*-2}%][{$@spelldesc304633=$?a137033[Insanity]?(a137032|a137031|a137021|a137020|a137019|a137012|a137029|a137028|a137024|a137039)[Mana]?a137027[Holy Power]?(a137050|a137049|a137048|a137010)[Rage]?(a137017|a137015|a137016)[Focus]?(a137011|a137025|a137023|a137037|a137036|a137035)[Energy]?a212613[Pain]?a212612[Fury]?(a137046|a137044|a137043)[Soul Shard]?(a137008|a137007|a137006)[Rune]?(a137041|a137040)[Maelstrom]?a137013[Astral Power][]} generation increased by {$s1=100}%].$?$w2>0[ Leech increased by $w2.][]
  • description:Clear your mind and attune yourself with the Heart of Azeroth, $?a137028[increasing your Shield of the Righteous recharge rate by ${{$300120s1=50}*-2}%]?a137020[causing Frostbolt and Flurry to generate an additional Icicle]?a137019[increasing your Fire Blast recharge rate by ${{$303399s1=50}*-2}%][increasing your {$@spelldesc304633=$?a137033[Insanity]?(a137032|a137031|a137021|a137020|a137019|a137012|a137029|a137028|a137024|a137039)[Mana]?a137027[Holy Power]?(a137050|a137049|a137048|a137010)[Rage]?(a137017|a137015|a137016)[Focus]?(a137011|a137025|a137023|a137037|a137036|a137035)[Energy]?a212613[Pain]?a212612[Fury]?(a137046|a137044|a137043)[Soul Shard]?(a137008|a137007|a137006)[Rune]?(a137041|a137040)[Maelstrom]?a137013[Astral Power][]} generation rate by {$s1=100}%]$?a298377[ and ][]$?a137020&a298377[increases ][]$?a298377[your Leech by {$298268s6=224}][] for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:120.00
  • default_chance:0.00%
Moonkin Form 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Nature's Balance 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 399.0(399.0) 0.0

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_natures_balance
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.75

Stack Uptimes

  • natures_balance_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202430
  • name:Nature's Balance
  • tooltip:Grants $m3 Astral Power every $m4 sec while in combat or while below 50 Astral Power.
  • description:While in combat you generate $m3 Astral Power every $m4 sec. While out of combat your Astral Power rebalances to 50 instead of depleting to empty.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Overwhelming Power 4.6 3.5 64.1sec 33.6sec 48.17% 0.00% 3.5(49.2) 0.0

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.38%
  • overwhelming_power_2:1.42%
  • overwhelming_power_3:1.46%
  • overwhelming_power_4:1.50%
  • overwhelming_power_5:1.54%
  • overwhelming_power_6:1.58%
  • overwhelming_power_7:1.63%
  • overwhelming_power_8:1.67%
  • overwhelming_power_9:1.72%
  • overwhelming_power_10:1.77%
  • overwhelming_power_11:1.82%
  • overwhelming_power_12:1.88%
  • overwhelming_power_13:1.93%
  • overwhelming_power_14:1.99%
  • overwhelming_power_15:2.05%
  • overwhelming_power_16:2.11%
  • overwhelming_power_17:2.17%
  • overwhelming_power_18:2.24%
  • overwhelming_power_19:2.31%
  • overwhelming_power_20:2.38%
  • overwhelming_power_21:2.45%
  • overwhelming_power_22:2.53%
  • overwhelming_power_23:2.61%
  • overwhelming_power_24:2.68%
  • overwhelming_power_25:1.36%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Solar Empowerment 9.2 78.9 28.0sec 3.4sec 96.55% 94.52% 4.3(4.3) 0.0

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:13.29%
  • solar_empowerment_2:47.33%
  • solar_empowerment_3:35.93%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starlord 15.8 57.0 19.6sec 4.2sec 98.39% 93.19% 25.7(25.7) 7.4

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:15.22%
  • starlord_2:21.35%
  • starlord_3:61.81%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.3 1.2 61.0sec 45.6sec 23.74% 0.00% 1.2(1.2) 4.1

Buff details

  • buff initial source:lucid dreams
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.74%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
lucid dreams
starsurge Astral Power 72.7 2909.2 40.0 40.0 1679.7
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 86.05 799.27 (27.79%) 9.29 0.46 0.06%
celestial_alignment Astral Power 2.00 118.19 (4.11%) 59.10 1.81 1.51%
sunfire Astral Power 17.44 59.12 (2.06%) 3.39 0.00 0.00%
shooting_stars Astral Power 44.86 209.98 (7.30%) 4.68 0.27 0.13%
moonfire Astral Power 14.19 47.31 (1.64%) 3.33 0.00 0.00%
stellar_flare Astral Power 12.77 113.29 (3.94%) 8.87 0.04 0.04%
lunar_strike Astral Power 76.92 1019.87 (35.46%) 13.26 6.71 0.65%
lucid_dreams Astral Power 10.92 218.30 (7.59%) 20.00 0.00 0.00%
natures_balance Astral Power 400.01 199.83 (6.95%) 0.50 0.17 0.09%
arcanic_pulsar Astral Power 7.58 90.95 (3.16%) 12.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 9.60 9.71
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 24.20 0.00 82.00
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.1%

Statistics & Data Analysis

Fight Length
Sample Data lucid dreams Fight Length
Count 15384
Mean 299.63
Minimum 240.01
Maximum 359.99
Spread ( max - min ) 119.97
Range [ ( max - min ) / 2 * 100% ] 20.02%
DPS
Sample Data lucid dreams Damage Per Second
Count 15384
Mean 43232.58
Minimum 38629.52
Maximum 48542.66
Spread ( max - min ) 9913.14
Range [ ( max - min ) / 2 * 100% ] 11.46%
Standard Deviation 1367.2136
5th Percentile 41053.15
95th Percentile 45549.24
( 95th Percentile - 5th Percentile ) 4496.09
Mean Distribution
Standard Deviation 11.0230
95.00% Confidence Intervall ( 43210.97 - 43254.18 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 39
0.1% Error 3842
0.1 Scale Factor Error with Delta=300 15958
0.05 Scale Factor Error with Delta=300 63829
0.01 Scale Factor Error with Delta=300 1595719
Priority Target DPS
Sample Data lucid dreams Priority Target Damage Per Second
Count 15384
Mean 43232.58
Minimum 38629.52
Maximum 48542.66
Spread ( max - min ) 9913.14
Range [ ( max - min ) / 2 * 100% ] 11.46%
Standard Deviation 1367.2136
5th Percentile 41053.15
95th Percentile 45549.24
( 95th Percentile - 5th Percentile ) 4496.09
Mean Distribution
Standard Deviation 11.0230
95.00% Confidence Intervall ( 43210.97 - 43254.18 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 39
0.1% Error 3842
0.1 Scale Factor Error with Delta=300 15958
0.05 Scale Factor Error with Delta=300 63829
0.01 Scale Factor Error with Delta=300 1595719
DPS(e)
Sample Data lucid dreams Damage Per Second (Effective)
Count 15384
Mean 43232.58
Minimum 38629.52
Maximum 48542.66
Spread ( max - min ) 9913.14
Range [ ( max - min ) / 2 * 100% ] 11.46%
Damage
Sample Data lucid dreams Damage
Count 15384
Mean 12926277.79
Minimum 9910337.97
Maximum 16266904.30
Spread ( max - min ) 6356566.34
Range [ ( max - min ) / 2 * 100% ] 24.59%
DTPS
Sample Data lucid dreams Damage Taken Per Second
Count 15384
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data lucid dreams Healing Per Second
Count 15384
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data lucid dreams Healing Per Second (Effective)
Count 15384
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data lucid dreams Heal
Count 15384
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data lucid dreams Healing Taken Per Second
Count 15384
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data lucid dreams Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data lucid dreamsTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data lucid dreams Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
E 1.00 potion,if=buff.ca_inc.remains>6&active_enemies=1
0.00 potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
0.00 blood_fury,if=buff.ca_inc.up
F 2.00 berserking,if=buff.ca_inc.up
0.00 arcane_torrent,if=buff.ca_inc.up
0.00 lights_judgment,if=buff.ca_inc.up
0.00 fireblood,if=buff.ca_inc.up
0.00 ancestral_call,if=buff.ca_inc.up
0.00 use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
0.00 use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
0.00 use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
0.00 use_item,name=tidestorm_codex,if=equipped.165576
G 2.93 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
H 2.87 memory_of_lucid_dreams,if=dot.sunfire.remains>10&dot.moonfire.remains>10&(astral_power<40|cooldown.ca_inc.remains>30)&dot.stellar_flare.remains>10&!buff.ca_inc.up
0.00 purifying_blast
0.00 ripple_in_space
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=(buff.memory_of_lucid_dreams.up|(cooldown.memory_of_lucid_dreams.remains>20&astral_power>=40&ap_check))&dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&!buff.ca_inc.up
I 2.00 celestial_alignment,if=(buff.memory_of_lucid_dreams.up|(cooldown.memory_of_lucid_dreams.remains>20&astral_power>=40&ap_check))&!buff.ca_inc.up&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
0.00 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
J 7.41 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
0.00 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
K 72.73 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
L 3.11 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
M 2.49 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
N 13.98 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
O 11.69 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
P 12.77 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
Q 77.11 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
R 85.29 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
S 0.36 sunfire

Sample Sequence

0123456789ACDKONPKHIFGKRKRQKRQKRQKNRJKORQRQKPRKRQKRQKRQKQNQQRKKORQQKRPQKRQNQRRRRKRKRKRQOQKQNPRQRRRRKKQROQRKNRQKPRQRRQKKRQRKRLOQQKQQRPRRKKNQQGKOHRQKRQRKRQJKRNPKRQRKRQMRKQQQJKRKNRQKPRQRKORQQRRKKNQQKRQFRKPMQQIERJKNKRQRQKRQKRQRKRQRQLOKPQKQQQKRQRKRQNRRORKKPQRKRQRGQKNHRQJKRQKORRKPKRQKRQRLRJKQKRQRQKRKR

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask lucid dreams 58.0/100: 58% astral_power
Pre precombat 1 food lucid dreams 58.0/100: 58% astral_power
Pre precombat 2 augmentation lucid dreams 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 9 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power battle_potion_of_intellect
0:00.000 default K starsurge Fluffy_Pillow 66.0/100: 66% astral_power battle_potion_of_intellect
0:01.237 default O moonfire Fluffy_Pillow 26.5/100: 27% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:02.161 default N sunfire Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:03.085 default P stellar_flare Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:04.011 default K starsurge Fluffy_Pillow 46.5/100: 47% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:04.936 default H memory_of_lucid_dreams Fluffy_Pillow 7.0/100: 7% astral_power bloodlust, arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(2), battle_potion_of_intellect
0:05.835 default I celestial_alignment Fluffy_Pillow 7.5/100: 8% astral_power bloodlust, memory_of_lucid_dreams, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), battle_potion_of_intellect
0:06.617 default F berserking Fluffy_Pillow 88.0/100: 88% astral_power bloodlust, memory_of_lucid_dreams, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), battle_potion_of_intellect
0:06.617 default G use_items Fluffy_Pillow 88.0/100: 88% astral_power bloodlust, berserking, memory_of_lucid_dreams, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), battle_potion_of_intellect
0:06.617 default K starsurge Fluffy_Pillow 88.0/100: 88% astral_power bloodlust, berserking, memory_of_lucid_dreams, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), battle_potion_of_intellect, ignition_mages_fuse
0:07.372 default R solar_wrath Fluffy_Pillow 68.5/100: 69% astral_power bloodlust, berserking, memory_of_lucid_dreams, lucid_dreams, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(3), starlord(3), battle_potion_of_intellect, ignition_mages_fuse
0:08.127 default K starsurge Fluffy_Pillow 85.0/100: 85% astral_power bloodlust, berserking, memory_of_lucid_dreams, lucid_dreams, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse
0:08.881 default R solar_wrath Fluffy_Pillow 45.5/100: 46% astral_power bloodlust, berserking, memory_of_lucid_dreams, lucid_dreams, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(3), starlord(3), battle_potion_of_intellect, ignition_mages_fuse
0:09.636 default Q lunar_strike Fluffy_Pillow 62.0/100: 62% astral_power bloodlust, berserking, memory_of_lucid_dreams, lucid_dreams, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse
0:10.480 default K starsurge Fluffy_Pillow 86.5/100: 87% astral_power bloodlust, berserking, memory_of_lucid_dreams, lucid_dreams, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse
0:11.234 default R solar_wrath Fluffy_Pillow 47.0/100: 47% astral_power bloodlust, berserking, memory_of_lucid_dreams, lucid_dreams, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment(3), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.988 default Q lunar_strike Fluffy_Pillow 71.5/100: 72% astral_power bloodlust, berserking, memory_of_lucid_dreams, lucid_dreams, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.799 default K starsurge Fluffy_Pillow 100.0/100: 100% astral_power bloodlust, berserking, memory_of_lucid_dreams, lucid_dreams, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.555 default R solar_wrath Fluffy_Pillow 60.5/100: 61% astral_power bloodlust, berserking, memory_of_lucid_dreams, lucid_dreams, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment(3), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:14.309 default Q lunar_strike Fluffy_Pillow 77.0/100: 77% astral_power bloodlust, berserking, memory_of_lucid_dreams, lucid_dreams, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:15.119 default K starsurge Fluffy_Pillow 100.0/100: 100% astral_power bloodlust, berserking, memory_of_lucid_dreams, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.874 default N sunfire Fluffy_Pillow 60.5/100: 61% astral_power bloodlust, berserking, memory_of_lucid_dreams, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment(3), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.628 default R solar_wrath Fluffy_Pillow 67.0/100: 67% astral_power bloodlust, berserking, memory_of_lucid_dreams, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment(3), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.384 default J cancel_buff Fluffy_Pillow 83.5/100: 84% astral_power bloodlust, berserking, memory_of_lucid_dreams, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.384 default K starsurge Fluffy_Pillow 83.5/100: 84% astral_power bloodlust, berserking, memory_of_lucid_dreams, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), battle_potion_of_intellect, ignition_mages_fuse(3)
0:18.136 default O moonfire Fluffy_Pillow 44.0/100: 44% astral_power bloodlust, berserking, memory_of_lucid_dreams, arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), solar_empowerment(3), starlord, battle_potion_of_intellect, ignition_mages_fuse(3)
0:18.892 default R solar_wrath Fluffy_Pillow 50.5/100: 51% astral_power bloodlust, memory_of_lucid_dreams, arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), solar_empowerment(3), starlord, battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.648 default Q lunar_strike Fluffy_Pillow 67.0/100: 67% astral_power bloodlust, memory_of_lucid_dreams, arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord, battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.520 default R solar_wrath Fluffy_Pillow 79.5/100: 80% astral_power bloodlust, arcanic_pulsar(8), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord, battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.275 default Q lunar_strike Fluffy_Pillow 88.0/100: 88% astral_power bloodlust, arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord, battle_potion_of_intellect, ignition_mages_fuse(4)
0:22.146 default K starsurge Fluffy_Pillow 100.0/100: 100% astral_power bloodlust, arcanic_pulsar(8), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, battle_potion_of_intellect, ignition_mages_fuse(4)
0:22.901 default P stellar_flare Fluffy_Pillow 72.5/100: 73% astral_power bloodlust, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), battle_potion_of_intellect, ignition_mages_fuse(5)
0:23.656 default R solar_wrath Fluffy_Pillow 81.0/100: 81% astral_power bloodlust, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), torrent_of_elements, ignition_mages_fuse(5)
0:24.409 default K starsurge Fluffy_Pillow 89.5/100: 90% astral_power bloodlust, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), torrent_of_elements, ignition_mages_fuse(5)
0:25.164 default R solar_wrath Fluffy_Pillow 70.0/100: 70% astral_power bloodlust, lucid_dreams, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, ignition_mages_fuse(5)
0:25.919 default Q lunar_strike Fluffy_Pillow 78.5/100: 79% astral_power bloodlust, lucid_dreams, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, ignition_mages_fuse(5)
0:26.715 default K starsurge Fluffy_Pillow 91.0/100: 91% astral_power bloodlust, lucid_dreams, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements
0:27.478 default R solar_wrath Fluffy_Pillow 51.5/100: 52% astral_power bloodlust, lucid_dreams, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements
0:28.233 default Q lunar_strike Fluffy_Pillow 60.0/100: 60% astral_power bloodlust, lucid_dreams, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements
0:29.204 default K starsurge Fluffy_Pillow 72.5/100: 73% astral_power bloodlust, lucid_dreams, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements
0:29.965 default R solar_wrath Fluffy_Pillow 33.0/100: 33% astral_power bloodlust, lucid_dreams, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements
0:30.720 default Q lunar_strike Fluffy_Pillow 41.5/100: 42% astral_power bloodlust, lucid_dreams, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements
0:31.689 default K starsurge Fluffy_Pillow 54.5/100: 55% astral_power bloodlust, lucid_dreams, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements
0:32.450 default Q lunar_strike Fluffy_Pillow 15.0/100: 15% astral_power bloodlust, arcanic_pulsar(4), lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements
0:33.564 default N sunfire Fluffy_Pillow 27.5/100: 28% astral_power bloodlust, arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements
0:34.439 default Q lunar_strike Fluffy_Pillow 31.0/100: 31% astral_power bloodlust, arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements
0:35.554 default Q lunar_strike Fluffy_Pillow 44.0/100: 44% astral_power bloodlust, arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements
0:36.667 default R solar_wrath Fluffy_Pillow 56.5/100: 56% astral_power bloodlust, arcanic_pulsar(4), solar_empowerment(2), starlord(3), torrent_of_elements
0:37.421 default K starsurge Fluffy_Pillow 65.0/100: 65% astral_power bloodlust, arcanic_pulsar(4), solar_empowerment, torrent_of_elements
0:38.376 default K starsurge Fluffy_Pillow 46.0/100: 46% astral_power bloodlust, lucid_dreams, arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord, torrent_of_elements
0:39.302 default O moonfire Fluffy_Pillow 6.5/100: 7% astral_power bloodlust, lucid_dreams, arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(2)
0:40.202 default R solar_wrath Fluffy_Pillow 14.0/100: 14% astral_power bloodlust, lucid_dreams, arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(2)
0:40.968 default Q lunar_strike Fluffy_Pillow 22.5/100: 23% astral_power bloodlust, lucid_dreams, arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(2)
0:42.114 default Q lunar_strike Fluffy_Pillow 39.5/100: 40% astral_power lucid_dreams, arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2)
0:43.602 default K starsurge Fluffy_Pillow 52.5/100: 53% astral_power lucid_dreams, arcanic_pulsar(6), solar_empowerment(2), starlord(2)
0:44.771 default R solar_wrath Fluffy_Pillow 17.0/100: 17% astral_power lucid_dreams, arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(25)
0:45.654 default P stellar_flare Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(24)
0:46.697 default Q lunar_strike Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(23)
0:48.029 default K starsurge Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), overwhelming_power(21)
0:49.083 default R solar_wrath Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(20)
0:49.982 default Q lunar_strike Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(20)
0:51.329 default N sunfire Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(18)
0:52.395 default Q lunar_strike Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(17)
0:53.756 default R solar_wrath Fluffy_Pillow 54.0/100: 54% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(16)
0:54.666 default R solar_wrath Fluffy_Pillow 62.5/100: 63% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(15)
0:55.582 default R solar_wrath Fluffy_Pillow 71.5/100: 72% astral_power arcanic_pulsar(8), starlord(3), torrent_of_elements, overwhelming_power(14)
0:56.661 default R solar_wrath Fluffy_Pillow 84.0/100: 84% astral_power arcanic_pulsar(8), starlord(3), torrent_of_elements, overwhelming_power(13), conch_of_dark_whispers
0:57.745 default K starsurge Fluffy_Pillow 92.5/100: 93% astral_power arcanic_pulsar(8), torrent_of_elements, overwhelming_power(12), conch_of_dark_whispers
0:58.932 default R solar_wrath Fluffy_Pillow 65.5/100: 66% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(11), conch_of_dark_whispers
0:59.787 default K starsurge Fluffy_Pillow 74.0/100: 74% astral_power celestial_alignment, lunar_empowerment, starlord, torrent_of_elements, overwhelming_power(10), conch_of_dark_whispers
1:00.795 default R solar_wrath Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(9), conch_of_dark_whispers
1:01.631 default K starsurge Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(8), conch_of_dark_whispers
1:02.619 default R solar_wrath Fluffy_Pillow 4.0/100: 4% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(7), conch_of_dark_whispers
1:03.439 default Q lunar_strike Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(6), conch_of_dark_whispers
1:04.672 default O moonfire Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(2), lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(5), conch_of_dark_whispers
1:05.789 default Q lunar_strike Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(2), lunar_empowerment(2), starlord(3), overwhelming_power(4), conch_of_dark_whispers
1:07.215 default K starsurge Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(2), conch_of_dark_whispers
1:08.343 default Q lunar_strike Fluffy_Pillow 3.0/100: 3% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power, conch_of_dark_whispers
1:09.785 default N sunfire Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, conch_of_dark_whispers
1:10.922 default P stellar_flare Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, conch_of_dark_whispers
1:12.057 default R solar_wrath Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, conch_of_dark_whispers
1:13.024 default Q lunar_strike Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers
1:14.471 default R solar_wrath Fluffy_Pillow 54.0/100: 54% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), torrent_of_elements
1:15.438 default R solar_wrath Fluffy_Pillow 62.5/100: 63% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), torrent_of_elements
1:16.404 default R solar_wrath Fluffy_Pillow 71.0/100: 71% astral_power arcanic_pulsar(3), starlord(3), torrent_of_elements
1:17.540 default R solar_wrath Fluffy_Pillow 80.0/100: 80% astral_power arcanic_pulsar(3), starlord(3), torrent_of_elements
1:18.677 default K starsurge Fluffy_Pillow 88.5/100: 89% astral_power arcanic_pulsar(3), torrent_of_elements
1:19.916 default K starsurge Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements
1:21.118 default Q lunar_strike Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements
1:22.607 default R solar_wrath Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(2), torrent_of_elements
1:23.602 default O moonfire Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements
1:24.772 default Q lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2)
1:26.261 default R solar_wrath Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar(5), solar_empowerment(3), starlord(2)
1:27.255 default K starsurge Fluffy_Pillow 57.5/100: 57% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(2)
1:28.423 default N sunfire Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(3)
1:29.559 default R solar_wrath Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(3)
1:30.527 default Q lunar_strike Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3)
1:31.976 default K starsurge Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3)
1:33.115 default P stellar_flare Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(3)
1:34.252 default R solar_wrath Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(3)
1:35.218 default Q lunar_strike Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3)
1:36.664 default R solar_wrath Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3)
1:37.630 default R solar_wrath Fluffy_Pillow 55.5/100: 56% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3)
1:38.595 default Q lunar_strike Fluffy_Pillow 64.0/100: 64% astral_power arcanic_pulsar(7), lunar_empowerment, starlord(3), conch_of_dark_whispers
1:40.042 default K starsurge Fluffy_Pillow 81.0/100: 81% astral_power arcanic_pulsar(7), conch_of_dark_whispers
1:41.280 default K starsurge Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord, conch_of_dark_whispers
1:42.483 default R solar_wrath Fluffy_Pillow 14.5/100: 14% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), conch_of_dark_whispers
1:43.349 default Q lunar_strike Fluffy_Pillow 23.0/100: 23% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), conch_of_dark_whispers
1:44.645 default R solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), conch_of_dark_whispers
1:45.509 default K starsurge Fluffy_Pillow 44.5/100: 45% astral_power celestial_alignment, lunar_empowerment, starlord(2), conch_of_dark_whispers
1:46.525 default R solar_wrath Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), conch_of_dark_whispers
1:47.367 default L sunfire Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(3), conch_of_dark_whispers
1:48.357 default O moonfire Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar, lunar_empowerment(3), starlord(3), conch_of_dark_whispers
1:49.492 default Q lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar, lunar_empowerment(3), starlord(3), conch_of_dark_whispers
1:50.939 default Q lunar_strike Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord(3), conch_of_dark_whispers
1:52.386 default K starsurge Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord(3), conch_of_dark_whispers
1:53.523 default Q lunar_strike Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), conch_of_dark_whispers
1:54.969 default Q lunar_strike Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3)
1:56.417 default R solar_wrath Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(2), solar_empowerment(3), starlord(3)
1:57.383 default P stellar_flare Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3)
1:58.519 default R solar_wrath Fluffy_Pillow 67.5/100: 68% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3)
1:59.486 default R solar_wrath Fluffy_Pillow 76.0/100: 76% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3)
2:00.451 default K starsurge Fluffy_Pillow 84.5/100: 85% astral_power arcanic_pulsar(2), lunar_empowerment
2:01.689 default K starsurge Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment, starlord
2:02.892 default N sunfire Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar(4), lunar_empowerment(3), solar_empowerment(2), starlord(2)
2:04.061 default Q lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(4), lunar_empowerment(3), solar_empowerment(2), starlord(2)
2:05.551 default Q lunar_strike Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2)
2:07.039 default G use_items Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2)
2:07.039 default K starsurge Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), ignition_mages_fuse
2:08.158 default O moonfire Fluffy_Pillow 0.5/100: 1% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), ignition_mages_fuse
2:09.247 default H memory_of_lucid_dreams Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), ignition_mages_fuse
2:10.337 default R solar_wrath Fluffy_Pillow 13.0/100: 13% astral_power memory_of_lucid_dreams, arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), ignition_mages_fuse
2:11.262 default Q lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power memory_of_lucid_dreams, arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), ignition_mages_fuse(2)
2:12.595 default K starsurge Fluffy_Pillow 62.5/100: 63% astral_power memory_of_lucid_dreams, arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), ignition_mages_fuse(2)
2:13.642 default R solar_wrath Fluffy_Pillow 23.5/100: 24% astral_power memory_of_lucid_dreams, arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3), ignition_mages_fuse(2)
2:14.530 default Q lunar_strike Fluffy_Pillow 40.0/100: 40% astral_power memory_of_lucid_dreams, arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(3), ignition_mages_fuse(2)
2:15.861 default R solar_wrath Fluffy_Pillow 65.0/100: 65% astral_power memory_of_lucid_dreams, arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(3), ignition_mages_fuse(3)
2:16.714 default K starsurge Fluffy_Pillow 81.5/100: 82% astral_power memory_of_lucid_dreams, arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(3), ignition_mages_fuse(3)
2:17.717 default R solar_wrath Fluffy_Pillow 42.0/100: 42% astral_power memory_of_lucid_dreams, arcanic_pulsar(7), lunar_empowerment(3), solar_empowerment(3), starlord(3), ignition_mages_fuse(3)
2:18.571 default Q lunar_strike Fluffy_Pillow 58.5/100: 59% astral_power memory_of_lucid_dreams, arcanic_pulsar(7), lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(25), ignition_mages_fuse(3)
2:19.753 default J cancel_buff Fluffy_Pillow 83.5/100: 84% astral_power memory_of_lucid_dreams, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(24), ignition_mages_fuse(4)
2:19.753 default K starsurge Fluffy_Pillow 83.5/100: 84% astral_power memory_of_lucid_dreams, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), overwhelming_power(24), ignition_mages_fuse(4)
2:20.732 default R solar_wrath Fluffy_Pillow 44.0/100: 44% astral_power memory_of_lucid_dreams, arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment(3), starlord, overwhelming_power(23), ignition_mages_fuse(4)
2:21.543 default N sunfire Fluffy_Pillow 60.5/100: 61% astral_power memory_of_lucid_dreams, arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment(2), starlord, overwhelming_power(22), ignition_mages_fuse(4)
2:22.499 default P stellar_flare Fluffy_Pillow 67.0/100: 67% astral_power memory_of_lucid_dreams, arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment(2), starlord, overwhelming_power(21), ignition_mages_fuse(4)
2:23.457 default K starsurge Fluffy_Pillow 92.0/100: 92% astral_power memory_of_lucid_dreams, arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment(2), starlord, overwhelming_power(20), ignition_mages_fuse(5)
2:24.388 default R solar_wrath Fluffy_Pillow 64.5/100: 65% astral_power celestial_alignment, lunar_empowerment(3), solar_empowerment(3), starlord(2), overwhelming_power(19), ignition_mages_fuse(5)
2:25.142 default Q lunar_strike Fluffy_Pillow 73.0/100: 73% astral_power celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(18), ignition_mages_fuse(5)
2:26.148 default R solar_wrath Fluffy_Pillow 85.5/100: 86% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(17), ignition_mages_fuse(5)
2:26.902 default K starsurge Fluffy_Pillow 98.0/100: 98% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(17), ignition_mages_fuse(5)
2:27.693 default R solar_wrath Fluffy_Pillow 58.5/100: 59% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(16)
2:28.488 default Q lunar_strike Fluffy_Pillow 67.0/100: 67% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(15)
2:29.682 default M moonfire Fluffy_Pillow 80.0/100: 80% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(14)
2:30.622 default R solar_wrath Fluffy_Pillow 83.5/100: 84% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(13)
2:31.543 default K starsurge Fluffy_Pillow 92.5/100: 93% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(12)
2:32.631 default Q lunar_strike Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(11)
2:34.022 default Q lunar_strike Fluffy_Pillow 66.0/100: 66% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(9)
2:35.423 default Q lunar_strike Fluffy_Pillow 79.0/100: 79% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(8)
2:36.829 default J cancel_buff Fluffy_Pillow 92.0/100: 92% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(7)
2:36.829 default K starsurge Fluffy_Pillow 92.0/100: 92% astral_power arcanic_pulsar(2), solar_empowerment(2), torrent_of_elements, overwhelming_power(7)
2:38.035 default R solar_wrath Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord, torrent_of_elements, overwhelming_power(5)
2:39.039 default K starsurge Fluffy_Pillow 61.5/100: 62% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(4)
2:40.223 default N sunfire Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(2), torrent_of_elements, overwhelming_power(3)
2:41.379 default R solar_wrath Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(2), torrent_of_elements, overwhelming_power(2)
2:42.365 default Q lunar_strike Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power
2:43.847 default K starsurge Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements
2:45.016 default P stellar_flare Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements
2:46.154 default R solar_wrath Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements
2:47.120 default Q lunar_strike Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements
2:48.568 default R solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements
2:49.535 default K starsurge Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements
2:50.671 default O moonfire Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3)
2:51.807 default R solar_wrath Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3)
2:52.772 default Q lunar_strike Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(3)
2:54.221 default Q lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3)
2:55.667 default R solar_wrath Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3)
2:56.635 default R solar_wrath Fluffy_Pillow 59.0/100: 59% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3)
2:57.603 default K starsurge Fluffy_Pillow 67.5/100: 68% astral_power arcanic_pulsar(6)
2:58.843 default K starsurge Fluffy_Pillow 48.5/100: 49% astral_power lucid_dreams, arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord
3:00.046 default N sunfire Fluffy_Pillow 9.5/100: 10% astral_power lucid_dreams, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2)
3:01.216 default Q lunar_strike Fluffy_Pillow 17.0/100: 17% astral_power lucid_dreams, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2)
3:02.705 default Q lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power lucid_dreams, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements
3:04.193 default K starsurge Fluffy_Pillow 43.0/100: 43% astral_power lucid_dreams, arcanic_pulsar(8), solar_empowerment(2), starlord(2), torrent_of_elements
3:05.359 default R solar_wrath Fluffy_Pillow 16.0/100: 16% astral_power lucid_dreams, celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements
3:06.200 default Q lunar_strike Fluffy_Pillow 24.5/100: 25% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements
3:07.460 default F berserking Fluffy_Pillow 37.0/100: 37% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers
3:07.460 default R solar_wrath Fluffy_Pillow 37.0/100: 37% astral_power berserking, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers
3:08.225 default K starsurge Fluffy_Pillow 45.5/100: 46% astral_power berserking, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, conch_of_dark_whispers
3:09.125 default P stellar_flare Fluffy_Pillow 6.5/100: 7% astral_power berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers
3:10.025 default M moonfire Fluffy_Pillow 15.0/100: 15% astral_power berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers
3:10.924 default Q lunar_strike Fluffy_Pillow 18.5/100: 19% astral_power berserking, arcanic_pulsar, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers
3:12.242 default Q lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power berserking, arcanic_pulsar, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers
3:13.559 default I celestial_alignment Fluffy_Pillow 44.5/100: 45% astral_power berserking, arcanic_pulsar, celestial_alignment, solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers
3:14.457 default E potion Fluffy_Pillow 85.0/100: 85% astral_power berserking, arcanic_pulsar, celestial_alignment, solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers
3:14.457 default R solar_wrath Fluffy_Pillow 85.0/100: 85% astral_power berserking, arcanic_pulsar, celestial_alignment, solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers, battle_potion_of_intellect
3:15.222 default J cancel_buff Fluffy_Pillow 93.5/100: 94% astral_power berserking, arcanic_pulsar, celestial_alignment, solar_empowerment, starlord(3), torrent_of_elements, conch_of_dark_whispers, battle_potion_of_intellect
3:15.222 default K starsurge Fluffy_Pillow 93.5/100: 94% astral_power berserking, arcanic_pulsar, celestial_alignment, solar_empowerment, torrent_of_elements, conch_of_dark_whispers, battle_potion_of_intellect
3:16.201 default N sunfire Fluffy_Pillow 74.0/100: 74% astral_power berserking, lucid_dreams, arcanic_pulsar(2), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord, torrent_of_elements, conch_of_dark_whispers, battle_potion_of_intellect
3:17.152 default K starsurge Fluffy_Pillow 77.5/100: 78% astral_power berserking, lucid_dreams, arcanic_pulsar(2), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord, conch_of_dark_whispers, battle_potion_of_intellect
3:18.104 default R solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power berserking, lucid_dreams, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(2), conch_of_dark_whispers, battle_potion_of_intellect
3:18.891 default Q lunar_strike Fluffy_Pillow 47.0/100: 47% astral_power berserking, lucid_dreams, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(25), conch_of_dark_whispers, battle_potion_of_intellect
3:19.968 default R solar_wrath Fluffy_Pillow 59.5/100: 60% astral_power lucid_dreams, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(24), conch_of_dark_whispers, battle_potion_of_intellect
3:20.763 default Q lunar_strike Fluffy_Pillow 68.0/100: 68% astral_power lucid_dreams, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(23), conch_of_dark_whispers, battle_potion_of_intellect
3:21.956 default K starsurge Fluffy_Pillow 81.0/100: 81% astral_power lucid_dreams, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(22), conch_of_dark_whispers, battle_potion_of_intellect
3:22.896 default R solar_wrath Fluffy_Pillow 41.5/100: 42% astral_power lucid_dreams, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(21), battle_potion_of_intellect
3:23.675 default Q lunar_strike Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(20), battle_potion_of_intellect
3:24.847 default K starsurge Fluffy_Pillow 63.0/100: 63% astral_power arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(19), battle_potion_of_intellect
3:25.771 default R solar_wrath Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(18), battle_potion_of_intellect
3:26.557 default Q lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(17), battle_potion_of_intellect
3:27.739 default R solar_wrath Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(16), battle_potion_of_intellect
3:28.534 default K starsurge Fluffy_Pillow 57.5/100: 57% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(15), battle_potion_of_intellect
3:29.472 default R solar_wrath Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(14), battle_potion_of_intellect
3:30.271 default Q lunar_strike Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(13), battle_potion_of_intellect
3:31.472 default R solar_wrath Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(12), battle_potion_of_intellect
3:32.277 default Q lunar_strike Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(11), battle_potion_of_intellect
3:33.486 default L sunfire Fluffy_Pillow 60.5/100: 61% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(10), battle_potion_of_intellect
3:34.440 default O moonfire Fluffy_Pillow 64.0/100: 64% astral_power arcanic_pulsar(6), lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(9), battle_potion_of_intellect
3:35.540 default K starsurge Fluffy_Pillow 68.0/100: 68% astral_power arcanic_pulsar(6), lunar_empowerment(2), overwhelming_power(8), battle_potion_of_intellect
3:36.741 default P stellar_flare Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(7), lunar_empowerment(3), solar_empowerment, starlord, overwhelming_power(7), battle_potion_of_intellect
3:37.913 default Q lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(7), lunar_empowerment(3), solar_empowerment, starlord, overwhelming_power(6), battle_potion_of_intellect
3:39.412 default K starsurge Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(4), battle_potion_of_intellect
3:40.595 default Q lunar_strike Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(3)
3:42.065 default Q lunar_strike Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(24)
3:43.431 default Q lunar_strike Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(23)
3:44.803 default K starsurge Fluffy_Pillow 54.0/100: 54% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(2), overwhelming_power(22)
3:45.882 default R solar_wrath Fluffy_Pillow 27.0/100: 27% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(21)
3:46.660 default Q lunar_strike Fluffy_Pillow 35.5/100: 36% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(20)
3:47.833 default R solar_wrath Fluffy_Pillow 48.0/100: 48% astral_power celestial_alignment, solar_empowerment(3), starlord(3), overwhelming_power(19)
3:48.619 default K starsurge Fluffy_Pillow 60.5/100: 61% astral_power celestial_alignment, solar_empowerment(2), starlord(3), overwhelming_power(18)
3:49.544 default R solar_wrath Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(17)
3:50.336 default Q lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(16)
3:51.525 default N sunfire Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar, solar_empowerment(2), starlord(3), overwhelming_power(15)
3:52.602 default R solar_wrath Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar, solar_empowerment(2), starlord(3), overwhelming_power(14)
3:53.519 default R solar_wrath Fluffy_Pillow 55.0/100: 55% astral_power arcanic_pulsar, solar_empowerment, starlord(3), overwhelming_power(13)
3:54.440 default O moonfire Fluffy_Pillow 63.5/100: 64% astral_power arcanic_pulsar, starlord(3), overwhelming_power(12)
3:55.529 default R solar_wrath Fluffy_Pillow 71.5/100: 72% astral_power arcanic_pulsar, starlord(3), overwhelming_power(11)
3:56.621 default K starsurge Fluffy_Pillow 80.0/100: 80% astral_power arcanic_pulsar, overwhelming_power(10), conch_of_dark_whispers
3:57.816 default K starsurge Fluffy_Pillow 61.0/100: 61% astral_power lucid_dreams, arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(9), conch_of_dark_whispers
3:58.980 default P stellar_flare Fluffy_Pillow 21.5/100: 22% astral_power lucid_dreams, arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(8), conch_of_dark_whispers
4:00.115 default Q lunar_strike Fluffy_Pillow 34.5/100: 35% astral_power lucid_dreams, arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(6), conch_of_dark_whispers
4:01.571 default R solar_wrath Fluffy_Pillow 47.5/100: 48% astral_power lucid_dreams, arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord(2), overwhelming_power(5), conch_of_dark_whispers
4:02.548 default K starsurge Fluffy_Pillow 56.0/100: 56% astral_power lucid_dreams, arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(4), conch_of_dark_whispers
4:03.700 default R solar_wrath Fluffy_Pillow 20.5/100: 21% astral_power lucid_dreams, arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(3), conch_of_dark_whispers
4:04.655 default Q lunar_strike Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(2), conch_of_dark_whispers
4:06.093 default R solar_wrath Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), conch_of_dark_whispers
4:07.060 default G use_items Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), conch_of_dark_whispers
4:07.060 default Q lunar_strike Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), conch_of_dark_whispers, ignition_mages_fuse
4:08.447 default K starsurge Fluffy_Pillow 64.0/100: 64% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers, ignition_mages_fuse
4:09.536 default N sunfire Fluffy_Pillow 44.5/100: 45% astral_power lucid_dreams, arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), conch_of_dark_whispers, ignition_mages_fuse
4:10.625 default H memory_of_lucid_dreams Fluffy_Pillow 48.5/100: 49% astral_power lucid_dreams, arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), conch_of_dark_whispers, ignition_mages_fuse
4:11.713 default R solar_wrath Fluffy_Pillow 49.0/100: 49% astral_power memory_of_lucid_dreams, lucid_dreams, arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), ignition_mages_fuse(2)
4:12.601 default Q lunar_strike Fluffy_Pillow 65.5/100: 66% astral_power memory_of_lucid_dreams, lucid_dreams, arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), ignition_mages_fuse(2)
4:13.934 default J cancel_buff Fluffy_Pillow 90.5/100: 91% astral_power memory_of_lucid_dreams, lucid_dreams, arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), ignition_mages_fuse(2)
4:13.934 default K starsurge Fluffy_Pillow 90.5/100: 91% astral_power memory_of_lucid_dreams, lucid_dreams, arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), ignition_mages_fuse(2)
4:15.072 default R solar_wrath Fluffy_Pillow 51.5/100: 52% astral_power memory_of_lucid_dreams, lucid_dreams, arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord, ignition_mages_fuse(3)
4:15.975 default Q lunar_strike Fluffy_Pillow 68.0/100: 68% astral_power memory_of_lucid_dreams, lucid_dreams, arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord, ignition_mages_fuse(3)
4:17.328 default K starsurge Fluffy_Pillow 93.0/100: 93% astral_power memory_of_lucid_dreams, arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord, ignition_mages_fuse(3)
4:18.391 default O moonfire Fluffy_Pillow 53.5/100: 54% astral_power memory_of_lucid_dreams, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(2), ignition_mages_fuse(3)
4:19.422 default R solar_wrath Fluffy_Pillow 60.0/100: 60% astral_power memory_of_lucid_dreams, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(2), ignition_mages_fuse(4)
4:20.266 default R solar_wrath Fluffy_Pillow 77.0/100: 77% astral_power memory_of_lucid_dreams, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), ignition_mages_fuse(4)
4:21.108 default K starsurge Fluffy_Pillow 93.5/100: 94% astral_power memory_of_lucid_dreams, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment, starlord(2), ignition_mages_fuse(4)
4:22.101 default P stellar_flare Fluffy_Pillow 74.0/100: 74% astral_power memory_of_lucid_dreams, lucid_dreams, arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment(2), starlord(3), ignition_mages_fuse(4)
4:23.067 default K starsurge Fluffy_Pillow 90.5/100: 91% astral_power memory_of_lucid_dreams, lucid_dreams, arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment(2), starlord(3), ignition_mages_fuse(5)
4:24.000 default R solar_wrath Fluffy_Pillow 63.0/100: 63% astral_power memory_of_lucid_dreams, lucid_dreams, celestial_alignment, lunar_empowerment(3), solar_empowerment(3), starlord(3), ignition_mages_fuse(5)
4:24.754 default Q lunar_strike Fluffy_Pillow 80.0/100: 80% astral_power memory_of_lucid_dreams, lucid_dreams, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), ignition_mages_fuse(5)
4:25.785 default K starsurge Fluffy_Pillow 92.5/100: 93% astral_power lucid_dreams, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), ignition_mages_fuse(5)
4:26.595 default R solar_wrath Fluffy_Pillow 53.0/100: 53% astral_power lucid_dreams, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(3), starlord(3), ignition_mages_fuse(5)
4:27.350 default Q lunar_strike Fluffy_Pillow 61.5/100: 62% astral_power lucid_dreams, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3)
4:28.608 default R solar_wrath Fluffy_Pillow 74.5/100: 75% astral_power lucid_dreams, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3)
4:29.448 default L sunfire Fluffy_Pillow 83.0/100: 83% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3)
4:30.437 default R solar_wrath Fluffy_Pillow 86.5/100: 87% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment(2), starlord(3)
4:31.404 default J cancel_buff Fluffy_Pillow 95.0/100: 95% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord(3)
4:31.404 default K starsurge Fluffy_Pillow 95.0/100: 95% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment
4:32.643 default Q lunar_strike Fluffy_Pillow 76.0/100: 76% astral_power lucid_dreams, arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment(2), starlord
4:34.175 default K starsurge Fluffy_Pillow 89.0/100: 89% astral_power lucid_dreams, arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord, overwhelming_power(23)
4:35.284 default R solar_wrath Fluffy_Pillow 50.0/100: 50% astral_power lucid_dreams, arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(3), starlord(2), overwhelming_power(22)
4:36.201 default Q lunar_strike Fluffy_Pillow 58.5/100: 59% astral_power lucid_dreams, arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(21)
4:37.582 default R solar_wrath Fluffy_Pillow 71.5/100: 72% astral_power lucid_dreams, arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(20)
4:38.505 default Q lunar_strike Fluffy_Pillow 80.0/100: 80% astral_power lucid_dreams, arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(19), conch_of_dark_whispers
4:39.893 default K starsurge Fluffy_Pillow 93.0/100: 93% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(18), conch_of_dark_whispers
4:40.986 default R solar_wrath Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(17), conch_of_dark_whispers
4:41.893 default K starsurge Fluffy_Pillow 62.0/100: 62% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(16), conch_of_dark_whispers
4:42.968 default R solar_wrath Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(5), lunar_empowerment(3), solar_empowerment(3), starlord(3), overwhelming_power(15), conch_of_dark_whispers

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 16238 14762 13761
Intellect 1467 -3 13346 11714 9693 (6045)
Spirit 0 0 0 0 0
Health 324760 295240 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 13346 11714 0
Crit 15.68% 15.68% 769
Haste 21.51% 21.51% 1463
Damage / Heal Versatility 4.81% 4.81% 409
ManaReg per Second 2378 640 0
Attack Power 13880 12183 0
Mastery 55.20% 55.20% 2005
Armor 2962 2962 2962
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 447.00
Local Head Hood of the Slithering Loa
ilevel: 450, stats: { 407 Armor, +1145 AgiInt, +2255 Sta }
Local Neck Heart of Azeroth
ilevel: 463, stats: { +325 Haste, +325 Crit, +325 Mastery, +719 Sta, +382 StrAgiInt }
Local Shoulders Gorak Tul's Mantle
ilevel: 450, stats: { 376 Armor, +859 AgiInt, +1691 Sta }
Local Chest Spymaster's Wrap
ilevel: 450, stats: { 501 Armor, +1145 AgiInt, +2255 Sta }
Local Waist Beloved Monarch's Waistwrap
ilevel: 445, stats: { 271 Armor, +431 AgiInt, +789 Sta, +147 Mastery, +82 Crit }
Local Legs Leggings of the Stormborn
ilevel: 445, stats: { 422 Armor, +575 AgiInt, +1053 Sta, +179 Vers, +126 Crit }
Local Feet Ancient Tempest Striders
ilevel: 445, stats: { 331 Armor, +431 AgiInt, +789 Sta, +134 Mastery, +95 Haste }
Local Wrists Tideblood Bracers
ilevel: 445, stats: { 211 Armor, +323 AgiInt, +592 Sta, +105 Haste, +66 Crit }
Local Hands Gloves of Incomparable Beauty
ilevel: 445, stats: { 301 Armor, +431 AgiInt, +789 Sta, +134 Haste, +95 Mastery }
Local Finger1 Boralus Noble's Seal
ilevel: 445, stats: { +592 Sta, +369 Mastery, +169 Haste }, enchant: { +60 Haste }
Local Finger2 Cursed Lover's Ring
ilevel: 445, stats: { +592 Sta, +307 Haste, +230 Vers }, enchant: { +60 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 445, stats: { +546 Int }
Local Trinket2 Conch of Dark Whispers
ilevel: 445, stats: { +546 Int }
Local Back Cloak of Ill Tidings
ilevel: 445, stats: { 142 Armor, +323 StrAgiInt, +592 Sta, +110 Mastery, +61 Crit }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 445, weapon: { 661 - 896, 3.6 }, stats: { +575 Int, +1053 Sta, +109 Haste, +109 Crit, +109 Mastery, +1981 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="lucid dreams"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
talents=1000231
azerite_override=lifespeed:450/heed_my_call:450/overwhelming_power:450/streaking_stars:450/streaking_stars:450/streaking_stars:450/arcanic_pulsar:450/loyal_to_the_end:450/loyal_to_the_end:450

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6&active_enemies=1
actions+=/potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
actions+=/blood_fury,if=buff.ca_inc.up
actions+=/berserking,if=buff.ca_inc.up
actions+=/arcane_torrent,if=buff.ca_inc.up
actions+=/lights_judgment,if=buff.ca_inc.up
actions+=/fireblood,if=buff.ca_inc.up
actions+=/ancestral_call,if=buff.ca_inc.up
actions+=/use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
actions+=/use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
actions+=/use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams,if=dot.sunfire.remains>10&dot.moonfire.remains>10&(astral_power<40|cooldown.ca_inc.remains>30)&dot.stellar_flare.remains>10&!buff.ca_inc.up
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=(buff.memory_of_lucid_dreams.up|(cooldown.memory_of_lucid_dreams.remains>20&astral_power>=40&ap_check))&dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&!buff.ca_inc.up
actions+=/celestial_alignment,if=(buff.memory_of_lucid_dreams.up|(cooldown.memory_of_lucid_dreams.remains>20&astral_power>=40&ap_check))&!buff.ca_inc.up&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=hood_of_the_slithering_loa,id=159318,ilevel=450
neck=heart_of_azeroth,id=158075,ilevel=463
shoulders=gorak_tuls_mantle,id=159339,ilevel=450
back=cloak_of_ill_tidings,id=168391,ilevel=445
chest=spymasters_wrap,id=155860,ilevel=450
wrists=tideblood_bracers,id=168377,ilevel=445
hands=gloves_of_incomparable_beauty,id=168887,ilevel=445
waist=beloved_monarchs_waistwrap,id=168871,ilevel=445
legs=leggings_of_the_stormborn,id=168378,ilevel=445
feet=ancient_tempest_striders,id=168380,ilevel=445
finger1=boralus_nobles_seal,id=168889,ilevel=445,enchant=60haste
finger2=cursed_lovers_ring,id=168891,ilevel=445,enchant=60haste
trinket1=ignition_mages_fuse,id=159615,ilevel=445
trinket2=conch_of_dark_whispers,id=159620,ilevel=445
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=445,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=447.20
# gear_stamina=13761
# gear_intellect=9693
# gear_crit_rating=769
# gear_haste_rating=1364
# gear_mastery_rating=1289
# gear_versatility_rating=409
# gear_armor=2962

purification protocol : 41030 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
41030.4 41030.4 19.9 / 0.049% 4911.7 / 12.0% 5037.4
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.1 8.0 Astral Power 0.00% 58.4 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Stellar Flare (Balance Druid)
  • 100: Shooting Stars (Balance Druid)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
purification protocol 41030
Heed My Call 297 (424) 0.7% (1.0%) 8.2 33.44sec 15484 0 Direct 8.2 9128 18262 10837 18.7%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.20 8.20 0.00 0.00 0.0000 0.0000 88843.46 88843.46 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.66 81.29% 9127.71 8921 9813 9125.27 0 9813 60828 60828 0.00
crit 1.53 18.71% 18261.94 17842 19626 14464.19 0 19626 28015 28015 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 127 0.3% 8.2 33.44sec 4647 0 Direct 8.2 3912 7824 4647 18.8%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.20 8.20 0.00 0.00 0.0000 0.0000 38100.42 38100.42 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.66 81.20% 3912.18 3823 4206 3912.21 3823 4206 26045 26045 0.00
crit 1.54 18.80% 7823.88 7646 8411 6189.03 0 8411 12056 12056 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 5798 14.1% 76.7 3.80sec 22629 17437 Direct 76.7 19057 38102 22629 18.8%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 76.69 76.69 0.00 0.00 1.2978 0.0000 1735456.40 1735456.40 0.00 17436.87 17436.87
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 62.31 81.24% 19057.01 10135 24211 19064.97 18320 20141 1187409 1187409 0.00
crit 14.38 18.76% 38102.08 20270 48422 38114.77 33843 43408 548048 548048 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 2852 7.0% 14.0 21.37sec 60830 60159 Direct 14.0 3280 6564 3894 18.7%  
Periodic 222.8 3022 6039 3585 18.7% 98.9%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.03 14.03 222.75 222.75 1.0112 1.3309 853231.81 853231.81 0.00 2746.63 60158.77
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.40 81.31% 3280.08 2981 4065 3282.28 3003 3597 37409 37409 0.00
crit 2.62 18.69% 6564.07 5963 8130 6196.56 0 8130 17209 17209 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 181.1 81.32% 3021.73 4 3785 3023.09 2941 3167 547386 547386 0.00
crit 41.6 18.68% 6038.81 3 7570 6041.33 5621 6599 251227 251227 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Purification Protocol 743 1.8% 16.7 17.25sec 13324 0 Direct 16.7 11227 22456 13324 18.7%  

Stats details: purification_protocol

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.70 16.70 0.00 0.00 0.0000 0.0000 222566.24 222566.24 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.58 81.32% 11226.85 10972 12069 11226.39 10972 11932 152505 152505 0.00
crit 3.12 18.68% 22455.60 21944 24139 21490.03 0 24139 70062 70062 0.00
 
 

Action details: purification_protocol

Static Values
  • id:295293
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:295293
  • name:Purification Protocol
  • school:physical
  • tooltip:
  • description:MOTHER has added a Purification Protocol to your Heart of Azeroth, allowing your damaging spells and abilities to release a blast of Azerite energy at your target, dealing ${{$s1=1920}*(1+$@versadmg)} Fire damage to any enemy within $295305A2 yds$?a295363[, and heals you for ${{$295293s4=869}*(1+$@versadmg)} every $295310t1 sec for {$295310d=8 seconds}][]. Purification Protocol deals {$s2=50}% additional damage against Aberrations.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:9969.52
  • base_dd_max:9969.52
  • base_dd_mult:1.00
 
Purifying Blast 0 (822) 0.0% (2.0%) 5.5 60.36sec 44926 39379

Stats details: purifying_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.47 0.00 0.00 0.00 1.1410 0.0000 0.00 0.00 0.00 39378.95 39378.95
 
 

Action details: purifying_blast

Static Values
  • id:295337
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:295337
  • name:Purifying Blast
  • school:physical
  • tooltip:
  • description:Call down a purifying beam upon the target area, dealing ${{$295293s3=1173}*(1+$@versadmg)*{$s2=7}} Fire damage over {$d=6 seconds}.$?a295364[ Has a low chance to immediately annihilate any specimen deemed unworthy by MOTHER.][]$?a295352[ When an enemy dies within the beam, your damage is increased by {$295354s1=10}% for {$295354d=8 seconds}.][] Any Aberration struck by the beam is stunned for {$295366d=3 seconds}.
 
    Purification Protocol (purifying_tick) 822 2.0% 37.9 7.63sec 6478 0 Periodic 37.9 5476 10955 6478 18.3% 0.0%

Stats details: purifying_tick

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 37.93 0.00 0.00 37.93 0.0000 0.0000 245724.67 245724.67 0.00 0.00 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 31.0 81.70% 5475.55 5364 5900 5475.26 5364 5811 169691 169691 0.00
crit 6.9 18.30% 10955.24 10728 11801 10946.51 0 11801 76034 76034 0.00
 
 

Action details: purifying_tick

Static Values
  • id:295293
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:295293
  • name:Purification Protocol
  • school:physical
  • tooltip:
  • description:MOTHER has added a Purification Protocol to your Heart of Azeroth, allowing your damaging spells and abilities to release a blast of Azerite energy at your target, dealing ${{$s1=1920}*(1+$@versadmg)} Fire damage to any enemy within $295305A2 yds$?a295363[, and heals you for ${{$295293s4=869}*(1+$@versadmg)} every $295310t1 sec for {$295310d=8 seconds}][]. Purification Protocol deals {$s2=50}% additional damage against Aberrations.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:4873.57
  • base_dd_max:4873.57
  • base_dd_mult:1.00
 
Shooting Stars 915 2.2% 44.4 6.57sec 6164 0 Direct 44.4 5193 10380 6164 18.7%  

Stats details: shooting_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.40 44.40 0.00 0.00 0.0000 0.0000 273713.97 273713.97 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.09 81.28% 5193.49 4769 6503 5195.68 4886 5733 187447 187447 0.00
crit 8.31 18.72% 10380.05 9539 13006 10377.00 0 12693 86267 86267 0.00
 
 

Action details: shooting_stars

Static Values
  • id:202497
  • school:astral
  • resource:none
  • range:50000.0
  • travel_speed:0.8000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating ${$202497m2/10} Astral Power.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.360000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Solar Wrath 3205 (5123) 7.8% (12.5%) 92.3 3.18sec 16603 18542 Direct 92.9 8699 17387 10327 18.7%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 92.35 92.87 0.00 0.00 0.8954 0.0000 959076.34 959076.34 0.00 18541.99 18541.99
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.47 81.26% 8699.15 7949 10838 8704.16 8361 9225 656483 656483 0.00
crit 17.40 18.74% 17387.18 15898 21676 17396.24 15898 20088 302593 302593 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (solar_empowerment) 1918 4.7% 73.9 3.96sec 7771 0 Direct 73.9 7771 0 7771 0.0%  

Stats details: solar_empowerment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.89 73.89 0.00 0.00 0.0000 0.0000 574179.36 574179.36 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.89 100.00% 7770.96 5962 16257 7774.76 6655 9426 574179 574179 0.00
 
 

Action details: solar_empowerment

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:5961.69
  • base_dd_max:5961.69
  • base_dd_mult:1.00
 
Starsurge 13472 32.9% 60.9 4.95sec 66193 63494 Direct 60.7 55993 111903 66412 18.6%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 60.88 60.68 0.00 0.00 1.0425 0.0000 4029847.56 4029847.56 0.00 63494.16 63494.16
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 49.37 81.37% 55993.22 51347 69612 56019.19 53795 58874 2764596 2764596 0.00
crit 11.31 18.63% 111902.64 102695 139223 111943.38 102695 126927 1265251 1265251 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Stellar Flare 1849 4.5% 12.7 23.57sec 43446 42367 Direct 12.7 2763 5523 3273 18.5%  
Periodic 220.3 1958 3914 2324 18.7% 98.1%

Stats details: stellar_flare

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.74 12.74 220.26 220.26 1.0255 1.3345 553487.55 553487.55 0.00 1802.88 42367.39
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.38 81.51% 2762.98 2570 3504 2763.66 2570 3054 28692 28692 0.00
crit 2.36 18.49% 5523.34 5140 7009 5076.97 0 7009 13009 13009 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 179.1 81.32% 1958.09 5 2453 1958.97 1901 2063 350737 350737 0.00
crit 41.1 18.68% 3914.42 10 4906 3916.03 3700 4323 161049 161049 0.00
 
 

Action details: stellar_flare

Static Values
  • id:202347
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
Spelldata
  • id:202347
  • name:Stellar Flare
  • school:astral
  • tooltip:Suffering $w2 Astral damage every $t2 sec.
  • description:Burns the target for {$s1=0} Astral damage, and then an additional $o2 damage over {$d=24 seconds}. |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.125000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.087500
  • base_td:0.00
  • base_td_mult:0.82
  • dot_duration:24.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Streaking Star (s) 5854 14.2% 89.7 3.10sec 19427 0 Direct 89.7 16390 32784 19427 18.5%  

Stats details: streaking_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 89.67 89.67 0.00 0.00 0.0000 0.0000 1742102.65 1742102.65 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.06 81.47% 16389.81 16021 17623 16389.66 16021 17384 1197470 1197470 0.00
crit 16.61 18.53% 32783.96 32042 35246 32784.09 32042 34979 544633 544633 0.00
 
 

Action details: streaking_stars

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 3178 7.8% 18.0 16.50sec 52699 51820 Direct 18.0 4505 9008 5339 18.5%  
Periodic 221.9 3246 6487 3851 18.7% 98.7%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.04 18.04 221.88 221.88 1.0170 1.3322 950893.53 950893.53 0.00 3028.89 51819.81
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.70 81.47% 4504.92 4112 5607 4505.58 4153 4867 66222 66222 0.00
crit 3.34 18.53% 9008.35 8225 11214 8729.76 0 11214 30123 30123 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 180.4 81.31% 3245.56 2 4065 3247.02 3142 3418 585546 585546 0.00
crit 41.5 18.69% 6487.47 9 8130 6490.25 5952 7020 269003 269003 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Simple Action Stats Execute Interval
purification protocol
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:purification protocol
  • harmful:false
  • if_expr:
 
Berserking 2.0 182.55sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.0 182.66sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.9027 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:251837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:purification protocol
  • harmful:false
  • if_expr:
 
Bountiful Captain's Feast (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:259410
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:purification protocol
  • harmful:false
  • if_expr:
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Battle Potion of Intellect (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:279151
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 7.2 53.5 44.3sec 5.0sec 92.80% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:11.55%
  • arcanic_pulsar_2:10.35%
  • arcanic_pulsar_3:10.96%
  • arcanic_pulsar_4:10.72%
  • arcanic_pulsar_5:13.82%
  • arcanic_pulsar_6:10.60%
  • arcanic_pulsar_7:10.76%
  • arcanic_pulsar_8:14.05%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 188.6sec 0.0sec 16.24% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.24%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Battle-Scarred Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Berserking 2.0 0.0 182.6sec 182.6sec 8.12% 7.63% 0.0(0.0) 2.0

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast) 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Celestial Alignment 8.2 0.0 37.5sec 37.5sec 25.85% 32.61% 0.0(0.0) 8.1

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:25.85%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Conch of Dark Whispers 4.3 1.2 60.9sec 45.6sec 23.71% 0.00% 1.2(1.2) 4.1

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_conch_of_dark_whispers
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Conch of Dark Whispers

Stat Buff details

  • stat:crit_rating
  • amount:913.59

Stack Uptimes

  • conch_of_dark_whispers_1:23.71%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271071
  • name:Conch of Dark Whispers
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc271072=Your spells have a chance to grant you {$271071s1=649} Critical Strike for {$271071d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Ignition Mage's Fuse 2.9 0.0 120.3sec 120.3sec 19.17% 0.00% 2.8(2.8) 2.8

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:366.08

Stack Uptimes

  • ignition_mages_fuse_1:3.94%
  • ignition_mages_fuse_2:3.89%
  • ignition_mages_fuse_3:3.84%
  • ignition_mages_fuse_4:3.78%
  • ignition_mages_fuse_5:3.73%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lunar Empowerment 34.1 45.5 8.9sec 3.8sec 81.74% 99.67% 1.8(1.8) 0.0

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:36.38%
  • lunar_empowerment_2:31.52%
  • lunar_empowerment_3:13.84%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Moonkin Form 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Nature's Balance 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 399.0(399.0) 0.0

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_natures_balance
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.75

Stack Uptimes

  • natures_balance_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202430
  • name:Nature's Balance
  • tooltip:Grants $m3 Astral Power every $m4 sec while in combat or while below 50 Astral Power.
  • description:While in combat you generate $m3 Astral Power every $m4 sec. While out of combat your Astral Power rebalances to 50 instead of depleting to empty.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Overwhelming Power 4.6 3.5 64.3sec 33.7sec 48.09% 0.00% 3.5(48.6) 0.0

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.38%
  • overwhelming_power_2:1.41%
  • overwhelming_power_3:1.46%
  • overwhelming_power_4:1.50%
  • overwhelming_power_5:1.54%
  • overwhelming_power_6:1.58%
  • overwhelming_power_7:1.63%
  • overwhelming_power_8:1.67%
  • overwhelming_power_9:1.72%
  • overwhelming_power_10:1.77%
  • overwhelming_power_11:1.82%
  • overwhelming_power_12:1.88%
  • overwhelming_power_13:1.93%
  • overwhelming_power_14:1.99%
  • overwhelming_power_15:2.04%
  • overwhelming_power_16:2.10%
  • overwhelming_power_17:2.17%
  • overwhelming_power_18:2.23%
  • overwhelming_power_19:2.30%
  • overwhelming_power_20:2.37%
  • overwhelming_power_21:2.44%
  • overwhelming_power_22:2.52%
  • overwhelming_power_23:2.60%
  • overwhelming_power_24:2.67%
  • overwhelming_power_25:1.37%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Solar Empowerment 24.5 51.8 12.1sec 3.9sec 85.52% 79.68% 0.3(0.3) 0.0

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:28.01%
  • solar_empowerment_2:39.56%
  • solar_empowerment_3:17.94%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starlord 15.2 45.7 20.3sec 4.9sec 97.06% 92.09% 15.8(15.8) 11.3

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:14.82%
  • starlord_2:22.30%
  • starlord_3:59.93%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.3 1.2 60.8sec 45.4sec 23.73% 0.00% 1.2(1.2) 4.1

Buff details

  • buff initial source:purification protocol
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.73%

Trigger Attempt Success

  • trigger_pct:99.98%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
purification protocol
starsurge Astral Power 60.9 2435.2 40.0 40.0 1654.8
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 93.35 746.75 (31.14%) 8.00 0.05 0.01%
celestial_alignment Astral Power 2.00 80.00 (3.34%) 40.00 0.00 0.00%
sunfire Astral Power 18.04 54.13 (2.26%) 3.00 0.00 0.00%
shooting_stars Astral Power 44.41 177.61 (7.41%) 4.00 0.01 0.00%
moonfire Astral Power 14.03 42.08 (1.76%) 3.00 0.00 0.00%
stellar_flare Astral Power 12.74 101.92 (4.25%) 8.00 0.00 0.00%
lunar_strike Astral Power 76.69 920.25 (38.38%) 12.00 0.06 0.01%
natures_balance Astral Power 400.01 200.00 (8.34%) 0.50 0.00 0.00%
arcanic_pulsar Astral Power 6.24 74.92 (3.12%) 12.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 8.00 8.13
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 20.29 0.00 78.00
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data purification protocol Fight Length
Count 15384
Mean 299.63
Minimum 240.01
Maximum 359.99
Spread ( max - min ) 119.97
Range [ ( max - min ) / 2 * 100% ] 20.02%
DPS
Sample Data purification protocol Damage Per Second
Count 15384
Mean 41030.35
Minimum 36795.74
Maximum 46756.36
Spread ( max - min ) 9960.62
Range [ ( max - min ) / 2 * 100% ] 12.14%
Standard Deviation 1260.2880
5th Percentile 39058.47
95th Percentile 43192.68
( 95th Percentile - 5th Percentile ) 4134.21
Mean Distribution
Standard Deviation 10.1610
95.00% Confidence Intervall ( 41010.44 - 41050.27 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 37
0.1% Error 3625
0.1 Scale Factor Error with Delta=300 13559
0.05 Scale Factor Error with Delta=300 54236
0.01 Scale Factor Error with Delta=300 1355887
Priority Target DPS
Sample Data purification protocol Priority Target Damage Per Second
Count 15384
Mean 41030.35
Minimum 36795.74
Maximum 46756.36
Spread ( max - min ) 9960.62
Range [ ( max - min ) / 2 * 100% ] 12.14%
Standard Deviation 1260.2880
5th Percentile 39058.47
95th Percentile 43192.68
( 95th Percentile - 5th Percentile ) 4134.21
Mean Distribution
Standard Deviation 10.1610
95.00% Confidence Intervall ( 41010.44 - 41050.27 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 37
0.1% Error 3625
0.1 Scale Factor Error with Delta=300 13559
0.05 Scale Factor Error with Delta=300 54236
0.01 Scale Factor Error with Delta=300 1355887
DPS(e)
Sample Data purification protocol Damage Per Second (Effective)
Count 15384
Mean 41030.35
Minimum 36795.74
Maximum 46756.36
Spread ( max - min ) 9960.62
Range [ ( max - min ) / 2 * 100% ] 12.14%
Damage
Sample Data purification protocol Damage
Count 15384
Mean 12267223.96
Minimum 9622822.55
Maximum 15179682.39
Spread ( max - min ) 5556859.85
Range [ ( max - min ) / 2 * 100% ] 22.65%
DTPS
Sample Data purification protocol Damage Taken Per Second
Count 15384
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data purification protocol Healing Per Second
Count 15384
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data purification protocol Healing Per Second (Effective)
Count 15384
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data purification protocol Heal
Count 15384
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data purification protocol Healing Taken Per Second
Count 15384
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data purification protocol Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data purification protocolTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data purification protocol Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
E 1.00 potion,if=buff.ca_inc.remains>6&active_enemies=1
0.00 potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
0.00 blood_fury,if=buff.ca_inc.up
F 2.00 berserking,if=buff.ca_inc.up
0.00 arcane_torrent,if=buff.ca_inc.up
0.00 lights_judgment,if=buff.ca_inc.up
0.00 fireblood,if=buff.ca_inc.up
0.00 ancestral_call,if=buff.ca_inc.up
0.00 use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
0.00 use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
0.00 use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
0.00 use_item,name=tidestorm_codex,if=equipped.165576
G 2.94 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams
H 5.47 purifying_blast
0.00 ripple_in_space
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
I 2.00 celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
0.00 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
J 2.92 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
0.00 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
K 60.88 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
L 3.01 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
M 2.78 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
N 14.58 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
O 11.24 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
P 12.74 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
Q 77.05 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
R 92.61 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
S 0.46 sunfire

Sample Sequence

0123456789ACDHKONPIFGKRQKRQKRQRQKRNRQORQRSKPKRLQKQQQRQRRRKRKRQRQRMKKNQPQKRQQRKRQRHNKOQQKRPQRKRQRRNQRKRKRKRMQQKPQQKNRQRRKOQRQKQRRNKPQHRRRRGKQOKRQRKRQLRKQRQRPRQRKKQOQKNRQRKQRRRRRRPKKNQOQKRQRKRHQQQRNKQIEFKPORQKRQKRQKRQRNRQKRMQKPQQKRQKRQLQRRRKKQOQKRQPKHNRQQGRRRKQKQRORKQNRRPQRRKRQJKRKLQQKQQRKRQ

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask purification protocol 58.0/100: 58% astral_power
Pre precombat 1 food purification protocol 58.0/100: 58% astral_power
Pre precombat 2 augmentation purification protocol 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 9 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power battle_potion_of_intellect
0:00.000 default H purifying_blast Fluffy_Pillow 66.0/100: 66% astral_power battle_potion_of_intellect
0:01.239 default K starsurge Fluffy_Pillow 66.5/100: 67% astral_power bloodlust, battle_potion_of_intellect
0:02.194 default O moonfire Fluffy_Pillow 27.0/100: 27% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:03.119 default N sunfire Fluffy_Pillow 31.0/100: 31% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:04.046 default P stellar_flare Fluffy_Pillow 34.5/100: 35% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:04.971 default I celestial_alignment Fluffy_Pillow 43.0/100: 43% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:05.778 default F berserking Fluffy_Pillow 83.5/100: 84% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:05.778 default G use_items Fluffy_Pillow 83.5/100: 84% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:05.778 default K starsurge Fluffy_Pillow 83.5/100: 84% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect, ignition_mages_fuse
0:06.534 default R solar_wrath Fluffy_Pillow 44.0/100: 44% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), battle_potion_of_intellect, ignition_mages_fuse
0:07.289 default Q lunar_strike Fluffy_Pillow 52.5/100: 53% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), battle_potion_of_intellect, ignition_mages_fuse
0:08.155 default K starsurge Fluffy_Pillow 69.0/100: 69% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), battle_potion_of_intellect, ignition_mages_fuse
0:08.911 default R solar_wrath Fluffy_Pillow 29.5/100: 30% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse
0:09.664 default Q lunar_strike Fluffy_Pillow 38.0/100: 38% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse
0:10.509 default K starsurge Fluffy_Pillow 55.0/100: 55% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.262 default R solar_wrath Fluffy_Pillow 15.5/100: 16% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.016 default Q lunar_strike Fluffy_Pillow 24.0/100: 24% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.825 default R solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.580 default Q lunar_strike Fluffy_Pillow 45.0/100: 45% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(25), battle_potion_of_intellect, ignition_mages_fuse(2)
0:14.335 default K starsurge Fluffy_Pillow 57.5/100: 57% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(24), battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.090 default R solar_wrath Fluffy_Pillow 18.0/100: 18% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(23), battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.845 default N sunfire Fluffy_Pillow 26.5/100: 27% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(23), battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.600 default R solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(22), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.353 default Q lunar_strike Fluffy_Pillow 38.5/100: 39% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(21), battle_potion_of_intellect, ignition_mages_fuse(3)
0:18.107 default O moonfire Fluffy_Pillow 51.0/100: 51% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(20), battle_potion_of_intellect, ignition_mages_fuse(4)
0:18.862 default R solar_wrath Fluffy_Pillow 54.5/100: 55% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(20), battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.615 default Q lunar_strike Fluffy_Pillow 63.0/100: 63% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(19), battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.393 default R solar_wrath Fluffy_Pillow 75.5/100: 76% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(18), battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.146 default S sunfire Fluffy_Pillow 84.0/100: 84% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(17), battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.900 default K starsurge Fluffy_Pillow 87.5/100: 88% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, overwhelming_power(17), battle_potion_of_intellect, ignition_mages_fuse(5)
0:22.656 default P stellar_flare Fluffy_Pillow 48.0/100: 48% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(16), battle_potion_of_intellect, ignition_mages_fuse(5)
0:23.412 default K starsurge Fluffy_Pillow 56.5/100: 56% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(15), ignition_mages_fuse(5)
0:24.167 default R solar_wrath Fluffy_Pillow 17.0/100: 17% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(14), conch_of_dark_whispers, ignition_mages_fuse(5)
0:24.921 default L sunfire Fluffy_Pillow 25.5/100: 26% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(14), conch_of_dark_whispers, ignition_mages_fuse(5)
0:25.677 default Q lunar_strike Fluffy_Pillow 29.0/100: 29% astral_power bloodlust, arcanic_pulsar(7), lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(13), conch_of_dark_whispers, ignition_mages_fuse(5)
0:26.579 default K starsurge Fluffy_Pillow 41.5/100: 42% astral_power bloodlust, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(12), conch_of_dark_whispers
0:27.440 default Q lunar_strike Fluffy_Pillow 2.0/100: 2% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(11), conch_of_dark_whispers
0:28.510 default Q lunar_strike Fluffy_Pillow 15.0/100: 15% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(24), conch_of_dark_whispers
0:29.533 default Q lunar_strike Fluffy_Pillow 27.5/100: 28% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(23), conch_of_dark_whispers
0:30.559 default R solar_wrath Fluffy_Pillow 40.0/100: 40% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment(2), starlord(3), overwhelming_power(22), conch_of_dark_whispers
0:31.314 default Q lunar_strike Fluffy_Pillow 48.5/100: 49% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(21), conch_of_dark_whispers
0:32.348 default R solar_wrath Fluffy_Pillow 61.5/100: 62% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(20), conch_of_dark_whispers
0:33.104 default R solar_wrath Fluffy_Pillow 70.0/100: 70% astral_power bloodlust, arcanic_pulsar(8), starlord(3), overwhelming_power(19), conch_of_dark_whispers
0:33.922 default R solar_wrath Fluffy_Pillow 78.5/100: 79% astral_power bloodlust, arcanic_pulsar(8), starlord(3), overwhelming_power(19), conch_of_dark_whispers
0:34.740 default K starsurge Fluffy_Pillow 91.0/100: 91% astral_power bloodlust, arcanic_pulsar(8), starlord(3), overwhelming_power(18), conch_of_dark_whispers
0:35.559 default R solar_wrath Fluffy_Pillow 63.5/100: 64% astral_power bloodlust, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(17), conch_of_dark_whispers
0:36.313 default K starsurge Fluffy_Pillow 72.0/100: 72% astral_power bloodlust, celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(16), conch_of_dark_whispers
0:37.068 default R solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(15), conch_of_dark_whispers
0:37.822 default Q lunar_strike Fluffy_Pillow 45.0/100: 45% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(15), conch_of_dark_whispers
0:38.740 default R solar_wrath Fluffy_Pillow 57.5/100: 57% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(14)
0:39.496 default Q lunar_strike Fluffy_Pillow 66.0/100: 66% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(13)
0:40.420 default R solar_wrath Fluffy_Pillow 78.5/100: 79% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(12)
0:41.174 default M moonfire Fluffy_Pillow 87.0/100: 87% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(11)
0:42.124 default K starsurge Fluffy_Pillow 91.0/100: 91% astral_power arcanic_pulsar, lunar_empowerment, overwhelming_power(10)
0:43.316 default K starsurge Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(9)
0:44.479 default N sunfire Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(8)
0:45.613 default Q lunar_strike Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(7)
0:47.063 default P stellar_flare Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(5)
0:48.208 default Q lunar_strike Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(4)
0:49.674 default K starsurge Fluffy_Pillow 55.0/100: 55% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(3)
0:50.830 default R solar_wrath Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(2)
0:51.788 default Q lunar_strike Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power
0:53.231 default Q lunar_strike Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements
0:54.677 default R solar_wrath Fluffy_Pillow 54.0/100: 54% astral_power arcanic_pulsar(4), solar_empowerment(3), starlord(3), torrent_of_elements
0:55.642 default K starsurge Fluffy_Pillow 63.0/100: 63% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), torrent_of_elements
0:56.781 default R solar_wrath Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements
0:57.746 default Q lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements
0:59.193 default R solar_wrath Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), torrent_of_elements
1:00.160 default H purifying_blast Fluffy_Pillow 54.0/100: 54% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements
1:01.295 default N sunfire Fluffy_Pillow 54.5/100: 55% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements
1:02.431 default K starsurge Fluffy_Pillow 58.5/100: 59% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, torrent_of_elements
1:03.669 default O moonfire Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord, torrent_of_elements
1:04.871 default Q lunar_strike Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord, torrent_of_elements
1:06.402 default Q lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord, torrent_of_elements
1:07.934 default K starsurge Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord, torrent_of_elements
1:09.140 default R solar_wrath Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(2)
1:10.135 default P stellar_flare Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2)
1:11.304 default Q lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2)
1:12.791 default R solar_wrath Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(7), solar_empowerment(3), starlord(2)
1:13.786 default K starsurge Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(2)
1:14.955 default R solar_wrath Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3)
1:15.923 default Q lunar_strike Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers
1:17.371 default R solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), conch_of_dark_whispers
1:18.336 default R solar_wrath Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), conch_of_dark_whispers
1:19.303 default N sunfire Fluffy_Pillow 56.5/100: 56% astral_power arcanic_pulsar(8), lunar_empowerment, starlord(3), conch_of_dark_whispers
1:20.440 default Q lunar_strike Fluffy_Pillow 60.5/100: 61% astral_power arcanic_pulsar(8), lunar_empowerment, starlord(3), conch_of_dark_whispers
1:21.888 default R solar_wrath Fluffy_Pillow 73.5/100: 74% astral_power arcanic_pulsar(8), starlord(3), conch_of_dark_whispers
1:23.024 default K starsurge Fluffy_Pillow 86.0/100: 86% astral_power arcanic_pulsar(8), conch_of_dark_whispers
1:24.261 default R solar_wrath Fluffy_Pillow 63.0/100: 63% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, conch_of_dark_whispers
1:25.150 default K starsurge Fluffy_Pillow 71.5/100: 72% astral_power celestial_alignment, lunar_empowerment, starlord, conch_of_dark_whispers
1:26.197 default R solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), conch_of_dark_whispers
1:27.062 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), conch_of_dark_whispers
1:28.078 default R solar_wrath Fluffy_Pillow 1.5/100: 2% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), conch_of_dark_whispers
1:28.920 default M moonfire Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), starlord(3), conch_of_dark_whispers
1:29.907 default Q lunar_strike Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar(2), lunar_empowerment(3), starlord(3), conch_of_dark_whispers
1:31.354 default Q lunar_strike Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(2), lunar_empowerment(2), starlord(3)
1:32.802 default K starsurge Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(2), lunar_empowerment, starlord(3)
1:33.939 default P stellar_flare Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment, starlord(3)
1:35.077 default Q lunar_strike Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment, starlord(3)
1:36.526 default Q lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3)
1:37.974 default K starsurge Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3)
1:39.111 default N sunfire Fluffy_Pillow 4.0/100: 4% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3)
1:40.246 default R solar_wrath Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3)
1:41.213 default Q lunar_strike Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3)
1:42.659 default R solar_wrath Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(4), solar_empowerment(3), starlord(3)
1:43.624 default R solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(4), solar_empowerment(2)
1:44.678 default K starsurge Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(4), solar_empowerment
1:45.915 default O moonfire Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord
1:47.117 default Q lunar_strike Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord
1:48.647 default R solar_wrath Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord
1:49.669 default Q lunar_strike Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord
1:51.201 default K starsurge Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(5), solar_empowerment, starlord
1:52.404 default Q lunar_strike Fluffy_Pillow 6.5/100: 7% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2)
1:53.893 default R solar_wrath Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(2)
1:54.887 default R solar_wrath Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(6), solar_empowerment, starlord(2)
1:55.879 default N sunfire Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(6), starlord(2)
1:57.047 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(6), starlord(2)
1:58.214 default P stellar_flare Fluffy_Pillow 1.5/100: 2% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(3)
1:59.351 default Q lunar_strike Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(24)
2:00.679 default H purifying_blast Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), overwhelming_power(23)
2:01.724 default R solar_wrath Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), overwhelming_power(22)
2:02.617 default R solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), overwhelming_power(21)
2:03.511 default R solar_wrath Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(7), starlord(3), overwhelming_power(20)
2:04.571 default R solar_wrath Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(7), starlord(3), overwhelming_power(19)
2:05.633 default G use_items Fluffy_Pillow 58.5/100: 59% astral_power arcanic_pulsar(7), overwhelming_power(18)
2:05.633 default K starsurge Fluffy_Pillow 58.5/100: 59% astral_power arcanic_pulsar(7), overwhelming_power(18), ignition_mages_fuse
2:06.748 default Q lunar_strike Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(17), ignition_mages_fuse
2:08.132 default O moonfire Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(8), solar_empowerment, starlord, overwhelming_power(15), ignition_mages_fuse
2:09.225 default K starsurge Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(8), solar_empowerment, starlord, overwhelming_power(14), ignition_mages_fuse
2:10.322 default R solar_wrath Fluffy_Pillow 12.5/100: 13% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(13), ignition_mages_fuse(2)
2:11.083 default Q lunar_strike Fluffy_Pillow 21.0/100: 21% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(12), ignition_mages_fuse(2)
2:12.227 default R solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power celestial_alignment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(11), ignition_mages_fuse(2)
2:12.993 default K starsurge Fluffy_Pillow 42.5/100: 43% astral_power celestial_alignment, solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(11), ignition_mages_fuse(2)
2:13.896 default R solar_wrath Fluffy_Pillow 3.0/100: 3% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(10), ignition_mages_fuse(3)
2:14.650 default Q lunar_strike Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(9), ignition_mages_fuse(3)
2:15.731 default L sunfire Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar, celestial_alignment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(8), ignition_mages_fuse(3)
2:16.582 default R solar_wrath Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(7), ignition_mages_fuse(3)
2:17.417 default K starsurge Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(6), ignition_mages_fuse(3)
2:18.400 default Q lunar_strike Fluffy_Pillow 1.0/100: 1% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(5), ignition_mages_fuse(4)
2:19.612 default R solar_wrath Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(4), ignition_mages_fuse(4)
2:20.424 default Q lunar_strike Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(3), ignition_mages_fuse(4)
2:21.645 default R solar_wrath Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(2), ignition_mages_fuse(5)
2:22.431 default P stellar_flare Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(2), starlord(3), torrent_of_elements, overwhelming_power(25), ignition_mages_fuse(5)
2:23.299 default R solar_wrath Fluffy_Pillow 60.5/100: 61% astral_power arcanic_pulsar(2), starlord(3), torrent_of_elements, overwhelming_power(24), ignition_mages_fuse(5)
2:24.167 default Q lunar_strike Fluffy_Pillow 69.0/100: 69% astral_power arcanic_pulsar(2), lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(23), ignition_mages_fuse(5)
2:25.274 default R solar_wrath Fluffy_Pillow 81.5/100: 82% astral_power arcanic_pulsar(2), starlord(3), overwhelming_power(22), ignition_mages_fuse(5)
2:26.146 default K starsurge Fluffy_Pillow 90.0/100: 90% astral_power arcanic_pulsar(2), overwhelming_power(21)
2:27.295 default K starsurge Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(20)
2:28.412 default Q lunar_strike Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(19)
2:29.802 default O moonfire Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(18)
2:30.897 default Q lunar_strike Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(17)
2:32.296 default K starsurge Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(2), overwhelming_power(15)
2:33.403 default N sunfire Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(14)
2:34.482 default R solar_wrath Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(25)
2:35.366 default Q lunar_strike Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(24)
2:36.696 default R solar_wrath Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), overwhelming_power(23)
2:37.586 default K starsurge Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), overwhelming_power(22)
2:38.635 default Q lunar_strike Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(21)
2:39.978 default R solar_wrath Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), overwhelming_power(20)
2:40.877 default R solar_wrath Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), overwhelming_power(19)
2:41.779 default R solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(6), starlord(3), overwhelming_power(18)
2:42.844 default R solar_wrath Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(6), starlord(3), overwhelming_power(17)
2:43.912 default R solar_wrath Fluffy_Pillow 60.0/100: 60% astral_power arcanic_pulsar(6), starlord(3), overwhelming_power(16)
2:44.985 default R solar_wrath Fluffy_Pillow 68.5/100: 69% astral_power arcanic_pulsar(6), starlord(3), overwhelming_power(15)
2:46.061 default P stellar_flare Fluffy_Pillow 77.5/100: 78% astral_power arcanic_pulsar(6), starlord(3), overwhelming_power(13)
2:47.147 default K starsurge Fluffy_Pillow 86.0/100: 86% astral_power arcanic_pulsar(6), overwhelming_power(12)
2:48.331 default K starsurge Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(11)
2:49.485 default N sunfire Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(10)
2:50.611 default Q lunar_strike Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(9)
2:52.051 default O moonfire Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(7), conch_of_dark_whispers
2:53.189 default Q lunar_strike Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(6), conch_of_dark_whispers
2:54.646 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(2), overwhelming_power(5), conch_of_dark_whispers
2:55.793 default R solar_wrath Fluffy_Pillow 14.0/100: 14% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(4), conch_of_dark_whispers
2:56.621 default Q lunar_strike Fluffy_Pillow 22.5/100: 23% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(3), conch_of_dark_whispers
2:57.866 default R solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power celestial_alignment, solar_empowerment(2), starlord(3), overwhelming_power(2), conch_of_dark_whispers
2:58.701 default K starsurge Fluffy_Pillow 44.0/100: 44% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power, conch_of_dark_whispers
2:59.685 default R solar_wrath Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), conch_of_dark_whispers
3:00.524 default H purifying_blast Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), conch_of_dark_whispers
3:01.668 default Q lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar, lunar_empowerment(3), solar_empowerment, starlord(3), conch_of_dark_whispers
3:03.115 default Q lunar_strike Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord(3), conch_of_dark_whispers
3:04.562 default Q lunar_strike Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord(3), conch_of_dark_whispers
3:06.009 default R solar_wrath Fluffy_Pillow 57.0/100: 57% astral_power arcanic_pulsar, solar_empowerment, starlord(3), conch_of_dark_whispers
3:06.974 default N sunfire Fluffy_Pillow 65.5/100: 66% astral_power arcanic_pulsar, lunar_empowerment, starlord(3), conch_of_dark_whispers
3:08.110 default K starsurge Fluffy_Pillow 69.0/100: 69% astral_power arcanic_pulsar, lunar_empowerment
3:09.349 default Q lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord
3:10.881 default I celestial_alignment Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, conch_of_dark_whispers
3:11.928 default E potion Fluffy_Pillow 95.5/100: 96% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, conch_of_dark_whispers
3:11.928 default F berserking Fluffy_Pillow 95.5/100: 96% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, conch_of_dark_whispers, battle_potion_of_intellect
3:11.928 default K starsurge Fluffy_Pillow 95.5/100: 96% astral_power berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, conch_of_dark_whispers, battle_potion_of_intellect
3:12.880 default P stellar_flare Fluffy_Pillow 56.5/100: 56% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), conch_of_dark_whispers, battle_potion_of_intellect
3:13.806 default O moonfire Fluffy_Pillow 65.0/100: 65% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), conch_of_dark_whispers, battle_potion_of_intellect
3:14.731 default R solar_wrath Fluffy_Pillow 68.5/100: 69% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), conch_of_dark_whispers, battle_potion_of_intellect
3:15.518 default Q lunar_strike Fluffy_Pillow 77.0/100: 77% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), conch_of_dark_whispers, battle_potion_of_intellect
3:16.696 default K starsurge Fluffy_Pillow 90.0/100: 90% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), conch_of_dark_whispers, battle_potion_of_intellect
3:17.620 default R solar_wrath Fluffy_Pillow 50.5/100: 51% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), conch_of_dark_whispers, battle_potion_of_intellect
3:18.384 default Q lunar_strike Fluffy_Pillow 59.0/100: 59% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), conch_of_dark_whispers, battle_potion_of_intellect
3:19.529 default K starsurge Fluffy_Pillow 72.0/100: 72% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), conch_of_dark_whispers, battle_potion_of_intellect
3:20.429 default R solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(24), conch_of_dark_whispers, battle_potion_of_intellect
3:21.185 default Q lunar_strike Fluffy_Pillow 41.0/100: 41% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(23), conch_of_dark_whispers, battle_potion_of_intellect
3:22.240 default K starsurge Fluffy_Pillow 57.5/100: 57% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(22), conch_of_dark_whispers, battle_potion_of_intellect
3:23.071 default R solar_wrath Fluffy_Pillow 26.0/100: 26% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(21), conch_of_dark_whispers, battle_potion_of_intellect
3:23.826 default Q lunar_strike Fluffy_Pillow 34.5/100: 35% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(21), conch_of_dark_whispers, battle_potion_of_intellect
3:24.887 default R solar_wrath Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(20), conch_of_dark_whispers, battle_potion_of_intellect
3:25.668 default N sunfire Fluffy_Pillow 56.0/100: 56% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(19), conch_of_dark_whispers, battle_potion_of_intellect
3:26.591 default R solar_wrath Fluffy_Pillow 59.5/100: 60% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(18), conch_of_dark_whispers, battle_potion_of_intellect
3:27.516 default Q lunar_strike Fluffy_Pillow 68.0/100: 68% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(17), conch_of_dark_whispers, battle_potion_of_intellect
3:28.699 default K starsurge Fluffy_Pillow 81.0/100: 81% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), torrent_of_elements, overwhelming_power(16), conch_of_dark_whispers, battle_potion_of_intellect
3:29.714 default R solar_wrath Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(15), conch_of_dark_whispers, battle_potion_of_intellect
3:30.557 default M moonfire Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), starlord, torrent_of_elements, overwhelming_power(14), conch_of_dark_whispers, battle_potion_of_intellect
3:31.551 default Q lunar_strike Fluffy_Pillow 54.0/100: 54% astral_power arcanic_pulsar(7), lunar_empowerment(3), starlord, torrent_of_elements, overwhelming_power(13), conch_of_dark_whispers, battle_potion_of_intellect
3:33.011 default K starsurge Fluffy_Pillow 67.0/100: 67% astral_power arcanic_pulsar(7), lunar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(11), conch_of_dark_whispers, battle_potion_of_intellect
3:34.166 default P stellar_flare Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(10), conch_of_dark_whispers, battle_potion_of_intellect
3:35.294 default Q lunar_strike Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(9), battle_potion_of_intellect
3:36.733 default Q lunar_strike Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(8), battle_potion_of_intellect
3:38.178 default K starsurge Fluffy_Pillow 62.0/100: 62% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(24)
3:39.249 default R solar_wrath Fluffy_Pillow 35.0/100: 35% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(23)
3:40.023 default Q lunar_strike Fluffy_Pillow 43.5/100: 44% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(22)
3:41.187 default K starsurge Fluffy_Pillow 64.0/100: 64% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(21)
3:42.101 default R solar_wrath Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(20)
3:42.884 default Q lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(20)
3:44.055 default L sunfire Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(18)
3:44.981 default Q lunar_strike Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(18)
3:46.338 default R solar_wrath Fluffy_Pillow 66.5/100: 67% astral_power arcanic_pulsar, solar_empowerment(3), starlord(3), overwhelming_power(16)
3:47.248 default R solar_wrath Fluffy_Pillow 75.0/100: 75% astral_power arcanic_pulsar, solar_empowerment(2), starlord(3), overwhelming_power(15)
3:48.163 default R solar_wrath Fluffy_Pillow 84.0/100: 84% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(14)
3:49.079 default K starsurge Fluffy_Pillow 92.5/100: 93% astral_power arcanic_pulsar, lunar_empowerment, overwhelming_power(13)
3:50.261 default K starsurge Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(12)
3:51.411 default Q lunar_strike Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(25)
3:52.773 default O moonfire Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(24)
3:53.846 default Q lunar_strike Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(23)
3:55.217 default K starsurge Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(21)
3:56.301 default R solar_wrath Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(20)
3:57.201 default Q lunar_strike Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(19)
3:58.552 default P stellar_flare Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(18)
3:59.616 default K starsurge Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(17)
4:00.683 default H purifying_blast Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(16)
4:01.754 default N sunfire Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(15)
4:02.831 default R solar_wrath Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(14)
4:03.749 default Q lunar_strike Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(13)
4:05.130 default Q lunar_strike Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(11)
4:06.522 default G use_items Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), overwhelming_power(10)
4:06.522 default R solar_wrath Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), overwhelming_power(10), ignition_mages_fuse
4:07.415 default R solar_wrath Fluffy_Pillow 58.5/100: 59% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), overwhelming_power(9), ignition_mages_fuse
4:08.310 default R solar_wrath Fluffy_Pillow 67.5/100: 68% astral_power arcanic_pulsar(5), starlord(3), overwhelming_power(8), ignition_mages_fuse
4:09.369 default K starsurge Fluffy_Pillow 76.0/100: 76% astral_power arcanic_pulsar(5), overwhelming_power(7), ignition_mages_fuse
4:10.527 default Q lunar_strike Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(6), ignition_mages_fuse(2)
4:11.905 default K starsurge Fluffy_Pillow 49.5/100: 50% astral_power arcanic_pulsar(6), solar_empowerment, starlord, overwhelming_power(5), ignition_mages_fuse(2)
4:12.992 default Q lunar_strike Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(4), ignition_mages_fuse(2)
4:14.340 default R solar_wrath Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(2), overwhelming_power(2), ignition_mages_fuse(2)
4:15.248 default O moonfire Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(7), solar_empowerment, starlord(2), overwhelming_power, ignition_mages_fuse(3)
4:16.276 default R solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(7), solar_empowerment, starlord(2), ignition_mages_fuse(3)
4:17.152 default K starsurge Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(7), starlord(2), ignition_mages_fuse(3)
4:18.184 default Q lunar_strike Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), ignition_mages_fuse(3)
4:19.462 default N sunfire Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), ignition_mages_fuse(4)
4:20.429 default R solar_wrath Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), ignition_mages_fuse(4)
4:21.252 default R solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), ignition_mages_fuse(4)
4:22.075 default P stellar_flare Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(8), lunar_empowerment, starlord(3), ignition_mages_fuse(4)
4:23.042 default Q lunar_strike Fluffy_Pillow 59.0/100: 59% astral_power arcanic_pulsar(8), lunar_empowerment, starlord(3), ignition_mages_fuse(5)
4:24.228 default R solar_wrath Fluffy_Pillow 76.0/100: 76% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), ignition_mages_fuse(5)
4:25.019 default R solar_wrath Fluffy_Pillow 84.5/100: 85% astral_power arcanic_pulsar(8), starlord(3), ignition_mages_fuse(5)
4:25.951 default K starsurge Fluffy_Pillow 97.0/100: 97% astral_power arcanic_pulsar(8), lunar_empowerment, starlord(3), ignition_mages_fuse(5)
4:26.882 default R solar_wrath Fluffy_Pillow 69.5/100: 70% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3)
4:27.723 default Q lunar_strike Fluffy_Pillow 78.0/100: 78% astral_power celestial_alignment, lunar_empowerment(2), starlord(3)
4:28.982 default J cancel_buff Fluffy_Pillow 91.0/100: 91% astral_power celestial_alignment, lunar_empowerment, starlord(3)
4:28.982 default K starsurge Fluffy_Pillow 91.0/100: 91% astral_power celestial_alignment, lunar_empowerment
4:30.060 default R solar_wrath Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord
4:30.949 default K starsurge Fluffy_Pillow 60.5/100: 61% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord
4:31.996 default L sunfire Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2)
4:33.012 default Q lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord(2)
4:34.502 default Q lunar_strike Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(2)
4:35.990 default K starsurge Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(2)
4:37.159 default Q lunar_strike Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3)
4:38.608 default Q lunar_strike Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements
4:40.056 default R solar_wrath Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(3), solar_empowerment(3), starlord(3), torrent_of_elements
4:41.021 default K starsurge Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), torrent_of_elements
4:42.157 default R solar_wrath Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements
4:43.123 default Q lunar_strike Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 16238 14762 13761
Intellect 1467 -3 13346 11714 9693 (6045)
Spirit 0 0 0 0 0
Health 324760 295240 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 13346 11714 0
Crit 15.68% 15.68% 769
Haste 21.51% 21.51% 1463
Damage / Heal Versatility 4.81% 4.81% 409
ManaReg per Second 2378 640 0
Attack Power 13880 12183 0
Mastery 55.20% 55.20% 2005
Armor 2962 2962 2962
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 447.00
Local Head Hood of the Slithering Loa
ilevel: 450, stats: { 407 Armor, +1145 AgiInt, +2255 Sta }
Local Neck Heart of Azeroth
ilevel: 463, stats: { +325 Haste, +325 Crit, +325 Mastery, +719 Sta, +382 StrAgiInt }
Local Shoulders Gorak Tul's Mantle
ilevel: 450, stats: { 376 Armor, +859 AgiInt, +1691 Sta }
Local Chest Spymaster's Wrap
ilevel: 450, stats: { 501 Armor, +1145 AgiInt, +2255 Sta }
Local Waist Beloved Monarch's Waistwrap
ilevel: 445, stats: { 271 Armor, +431 AgiInt, +789 Sta, +147 Mastery, +82 Crit }
Local Legs Leggings of the Stormborn
ilevel: 445, stats: { 422 Armor, +575 AgiInt, +1053 Sta, +179 Vers, +126 Crit }
Local Feet Ancient Tempest Striders
ilevel: 445, stats: { 331 Armor, +431 AgiInt, +789 Sta, +134 Mastery, +95 Haste }
Local Wrists Tideblood Bracers
ilevel: 445, stats: { 211 Armor, +323 AgiInt, +592 Sta, +105 Haste, +66 Crit }
Local Hands Gloves of Incomparable Beauty
ilevel: 445, stats: { 301 Armor, +431 AgiInt, +789 Sta, +134 Haste, +95 Mastery }
Local Finger1 Boralus Noble's Seal
ilevel: 445, stats: { +592 Sta, +369 Mastery, +169 Haste }, enchant: { +60 Haste }
Local Finger2 Cursed Lover's Ring
ilevel: 445, stats: { +592 Sta, +307 Haste, +230 Vers }, enchant: { +60 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 445, stats: { +546 Int }
Local Trinket2 Conch of Dark Whispers
ilevel: 445, stats: { +546 Int }
Local Back Cloak of Ill Tidings
ilevel: 445, stats: { 142 Armor, +323 StrAgiInt, +592 Sta, +110 Mastery, +61 Crit }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 445, weapon: { 661 - 896, 3.6 }, stats: { +575 Int, +1053 Sta, +109 Haste, +109 Crit, +109 Mastery, +1981 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="purification protocol"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
talents=1000231
azerite_override=lifespeed:450/heed_my_call:450/overwhelming_power:450/streaking_stars:450/streaking_stars:450/streaking_stars:450/arcanic_pulsar:450/loyal_to_the_end:450/loyal_to_the_end:450

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6&active_enemies=1
actions+=/potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
actions+=/blood_fury,if=buff.ca_inc.up
actions+=/berserking,if=buff.ca_inc.up
actions+=/arcane_torrent,if=buff.ca_inc.up
actions+=/lights_judgment,if=buff.ca_inc.up
actions+=/fireblood,if=buff.ca_inc.up
actions+=/ancestral_call,if=buff.ca_inc.up
actions+=/use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
actions+=/use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
actions+=/use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
actions+=/celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=hood_of_the_slithering_loa,id=159318,ilevel=450
neck=heart_of_azeroth,id=158075,ilevel=463
shoulders=gorak_tuls_mantle,id=159339,ilevel=450
back=cloak_of_ill_tidings,id=168391,ilevel=445
chest=spymasters_wrap,id=155860,ilevel=450
wrists=tideblood_bracers,id=168377,ilevel=445
hands=gloves_of_incomparable_beauty,id=168887,ilevel=445
waist=beloved_monarchs_waistwrap,id=168871,ilevel=445
legs=leggings_of_the_stormborn,id=168378,ilevel=445
feet=ancient_tempest_striders,id=168380,ilevel=445
finger1=boralus_nobles_seal,id=168889,ilevel=445,enchant=60haste
finger2=cursed_lovers_ring,id=168891,ilevel=445,enchant=60haste
trinket1=ignition_mages_fuse,id=159615,ilevel=445
trinket2=conch_of_dark_whispers,id=159620,ilevel=445
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=445,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=447.20
# gear_stamina=13761
# gear_intellect=9693
# gear_crit_rating=769
# gear_haste_rating=1364
# gear_mastery_rating=1289
# gear_versatility_rating=409
# gear_armor=2962

ripple in space : 40720 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
40720.3 40720.3 19.8 / 0.049% 4837.2 / 11.9% 5000.2
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.1 8.0 Astral Power 0.00% 58.4 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Stellar Flare (Balance Druid)
  • 100: Shooting Stars (Balance Druid)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
ripple in space 40720
Heed My Call 297 (424) 0.7% (1.0%) 8.2 32.84sec 15467 0 Direct 8.2 9128 18255 10823 18.6%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.22 8.22 0.00 0.00 0.0000 0.0000 88972.02 88972.02 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.69 81.43% 9127.56 8921 9813 9126.47 0 9813 61097 61097 0.00
crit 1.53 18.57% 18254.87 17842 19626 14379.73 0 19626 27875 27875 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 127 0.3% 8.2 32.84sec 4644 0 Direct 8.2 3912 7826 4644 18.7%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.22 8.22 0.00 0.00 0.0000 0.0000 38178.51 38178.51 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.68 81.28% 3911.53 3823 4206 3910.37 0 4206 26137 26137 0.00
crit 1.54 18.72% 7826.01 7646 8411 6186.13 0 8411 12042 12042 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 5937 14.6% 76.7 3.81sec 23181 17860 Direct 76.7 19529 39047 23181 18.7%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 76.66 76.66 0.00 0.00 1.2979 0.0000 1777038.05 1777038.05 0.00 17860.40 17860.40
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 62.31 81.29% 19528.69 10135 25776 19537.42 18753 20921 1216889 1216889 0.00
crit 14.35 18.71% 39047.34 20270 51553 39061.44 34296 45365 560149 560149 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 2928 7.2% 14.0 21.38sec 62448 61757 Direct 14.0 3380 6755 4013 18.8%  
Periodic 222.7 3102 6200 3680 18.7% 98.9%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.03 14.03 222.72 222.72 1.0112 1.3311 875956.94 875956.94 0.00 2819.78 61756.69
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.39 81.23% 3379.60 2981 4328 3381.98 3071 3738 38508 38508 0.00
crit 2.63 18.77% 6755.05 5963 8656 6378.18 0 8656 17784 17784 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 181.1 81.32% 3101.64 2 4030 3103.09 3005 3259 561770 561770 0.00
crit 41.6 18.68% 6199.63 4 8059 6202.15 5746 6767 257894 257894 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Ripple in Space 420 1.0% 5.5 60.37sec 22950 20108 Direct 5.4 23093 0 23093 0.0%  

Stats details: ripple_in_space

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.47 5.44 0.00 0.00 1.1414 0.0000 125515.63 125515.63 0.00 20108.24 20108.24
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.44 100.00% 23092.55 22641 24905 23091.56 22641 24528 125516 125516 0.00
 
 

Action details: ripple_in_space

Static Values
  • id:302731
  • school:fire
  • resource:none
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:302731
  • name:Ripple in Space
  • school:physical
  • tooltip:About to relocate with Ripple in Space.
  • description:Create an Azerite beacon at a target location. After {$d=4 seconds}, the Heart of Azeroth will relocate you to this beacon and deal {$s2=4952} Fire damage to all nearby enemies.$?a302780[ For {$302864d=10 seconds} after being relocated, you take {$302864s1=10}% reduced damage.][]
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:20572.62
  • base_dd_max:20572.62
  • base_dd_mult:1.00
 
Shooting Stars 940 2.3% 44.4 6.56sec 6329 0 Direct 44.4 5332 10657 6329 18.7%  

Stats details: shooting_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.42 44.42 0.00 0.00 0.0000 0.0000 281170.61 281170.61 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.10 81.27% 5331.87 4769 6923 5333.90 4972 5909 192491 192491 0.00
crit 8.32 18.73% 10656.66 9539 13847 10654.58 0 13847 88680 88680 0.00
 
 

Action details: shooting_stars

Static Values
  • id:202497
  • school:astral
  • resource:none
  • range:50000.0
  • travel_speed:0.8000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating ${$202497m2/10} Astral Power.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.360000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Solar Wrath 3294 (5265) 8.1% (12.9%) 92.4 3.18sec 17058 19046 Direct 92.9 8944 17881 10614 18.7%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 92.37 92.88 0.00 0.00 0.8956 0.0000 985808.25 985808.25 0.00 19045.78 19045.78
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.52 81.31% 8944.00 7949 11539 8949.44 8621 9473 675480 675480 0.00
crit 17.35 18.69% 17881.17 15898 23078 17893.39 16056 20463 310329 310329 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (solar_empowerment) 1971 4.8% 73.9 3.95sec 7985 0 Direct 73.9 7985 0 7985 0.0%  

Stats details: solar_empowerment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.86 73.86 0.00 0.00 0.0000 0.0000 589792.00 589792.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.86 100.00% 7984.83 5962 17308 7988.48 6867 9492 589792 589792 0.00
 
 

Action details: solar_empowerment

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8067.06
  • base_dd_max:8067.06
  • base_dd_mult:1.00
 
Starsurge 13787 33.9% 60.9 4.95sec 67758 64993 Direct 60.7 57312 114468 67973 18.7%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 60.87 60.68 0.00 0.00 1.0426 0.0000 4124491.47 4124491.47 0.00 64992.54 64992.54
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 49.36 81.35% 57311.56 51347 73781 57338.39 54920 60477 2828903 2828903 0.00
crit 11.32 18.65% 114468.43 102695 147561 114509.47 102695 135908 1295588 1295588 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Stellar Flare 1897 4.7% 12.7 23.57sec 44563 43447 Direct 12.7 2822 5642 3346 18.6%  
Periodic 220.2 2009 4016 2384 18.7% 98.1%

Stats details: stellar_flare

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.74 12.74 220.22 220.22 1.0258 1.3347 567721.19 567721.19 0.00 1849.26 43446.94
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.37 81.41% 2822.01 2570 3731 2822.63 2596 3140 29269 29269 0.00
crit 2.37 18.59% 5641.81 5140 7462 5207.41 0 7462 13359 13359 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 179.1 81.31% 2009.26 4 2612 2010.23 1949 2115 359774 359774 0.00
crit 41.2 18.69% 4015.95 13 5223 4017.54 3717 4355 165318 165318 0.00
 
 

Action details: stellar_flare

Static Values
  • id:202347
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
Spelldata
  • id:202347
  • name:Stellar Flare
  • school:astral
  • tooltip:Suffering $w2 Astral damage every $t2 sec.
  • description:Burns the target for {$s1=0} Astral damage, and then an additional $o2 damage over {$d=24 seconds}. |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.125000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.087500
  • base_td:0.00
  • base_td_mult:0.82
  • dot_duration:24.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Streaking Star (s) 5861 14.3% 89.7 3.10sec 19440 0 Direct 89.7 16387 32776 19440 18.6%  

Stats details: streaking_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 89.71 89.71 0.00 0.00 0.0000 0.0000 1743888.23 1743888.23 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 72.99 81.37% 16386.53 16021 17623 16386.58 16021 17360 1196134 1196134 0.00
crit 16.71 18.63% 32775.81 32042 35246 32774.03 32042 35246 547755 547755 0.00
 
 

Action details: streaking_stars

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 3262 8.0% 18.0 16.51sec 54116 53201 Direct 18.0 4632 9256 5491 18.6%  
Periodic 221.8 3332 6659 3954 18.7% 98.6%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.04 18.04 221.83 221.83 1.0173 1.3324 976129.40 976129.40 0.00 3109.44 53200.86
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.69 81.42% 4631.60 4112 5970 4632.25 4271 4998 68021 68021 0.00
crit 3.35 18.58% 9255.56 8225 11939 8994.89 0 11939 31019 31019 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 180.3 81.30% 3331.52 5 4328 3333.11 3228 3495 600817 600817 0.00
crit 41.5 18.70% 6658.56 4 8656 6661.46 6167 7389 276272 276272 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Simple Action Stats Execute Interval
ripple in space
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:ripple in space
  • harmful:false
  • if_expr:
 
Berserking 2.0 182.56sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.0 182.66sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.9028 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:251837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:ripple in space
  • harmful:false
  • if_expr:
 
Bountiful Captain's Feast (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:259410
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:ripple in space
  • harmful:false
  • if_expr:
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Battle Potion of Intellect (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:279151
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 7.2 53.5 44.3sec 5.0sec 92.80% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:11.55%
  • arcanic_pulsar_2:10.34%
  • arcanic_pulsar_3:10.95%
  • arcanic_pulsar_4:10.73%
  • arcanic_pulsar_5:13.82%
  • arcanic_pulsar_6:10.62%
  • arcanic_pulsar_7:10.78%
  • arcanic_pulsar_8:14.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 188.7sec 0.0sec 16.24% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.24%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Battle-Scarred Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Berserking 2.0 0.0 182.6sec 182.6sec 8.12% 7.72% 0.0(0.0) 2.0

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast) 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Celestial Alignment 8.2 0.0 37.5sec 37.5sec 25.85% 32.62% 0.0(0.0) 8.1

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:25.85%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Conch of Dark Whispers 4.3 1.2 61.0sec 45.6sec 23.69% 0.00% 1.2(1.2) 4.1

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_conch_of_dark_whispers
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Conch of Dark Whispers

Stat Buff details

  • stat:crit_rating
  • amount:913.59

Stack Uptimes

  • conch_of_dark_whispers_1:23.69%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271071
  • name:Conch of Dark Whispers
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc271072=Your spells have a chance to grant you {$271071s1=649} Critical Strike for {$271071d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Ignition Mage's Fuse 2.9 0.0 120.3sec 120.3sec 19.17% 0.00% 2.8(2.8) 2.8

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:366.08

Stack Uptimes

  • ignition_mages_fuse_1:3.94%
  • ignition_mages_fuse_2:3.89%
  • ignition_mages_fuse_3:3.83%
  • ignition_mages_fuse_4:3.78%
  • ignition_mages_fuse_5:3.73%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lunar Empowerment 34.1 45.4 8.9sec 3.8sec 81.70% 99.69% 1.8(1.8) 0.0

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:36.36%
  • lunar_empowerment_2:31.44%
  • lunar_empowerment_3:13.91%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Moonkin Form 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Nature's Balance 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 399.0(399.0) 0.0

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_natures_balance
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.75

Stack Uptimes

  • natures_balance_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202430
  • name:Nature's Balance
  • tooltip:Grants $m3 Astral Power every $m4 sec while in combat or while below 50 Astral Power.
  • description:While in combat you generate $m3 Astral Power every $m4 sec. While out of combat your Astral Power rebalances to 50 instead of depleting to empty.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Overwhelming Power 4.6 3.5 64.4sec 33.9sec 47.83% 0.00% 3.5(48.2) 0.0

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.37%
  • overwhelming_power_2:1.41%
  • overwhelming_power_3:1.45%
  • overwhelming_power_4:1.49%
  • overwhelming_power_5:1.53%
  • overwhelming_power_6:1.58%
  • overwhelming_power_7:1.62%
  • overwhelming_power_8:1.66%
  • overwhelming_power_9:1.71%
  • overwhelming_power_10:1.76%
  • overwhelming_power_11:1.81%
  • overwhelming_power_12:1.87%
  • overwhelming_power_13:1.92%
  • overwhelming_power_14:1.98%
  • overwhelming_power_15:2.03%
  • overwhelming_power_16:2.09%
  • overwhelming_power_17:2.16%
  • overwhelming_power_18:2.22%
  • overwhelming_power_19:2.29%
  • overwhelming_power_20:2.36%
  • overwhelming_power_21:2.43%
  • overwhelming_power_22:2.50%
  • overwhelming_power_23:2.58%
  • overwhelming_power_24:2.65%
  • overwhelming_power_25:1.34%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Reality Shift 5.4 0.0 60.4sec 60.4sec 35.19% 0.00% 105.2(105.2) 5.1

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_reality_shift
  • max_stacks:1
  • duration:20.00
  • cooldown:30.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:1.00

Stat Buff details

  • stat:intellect
  • amount:805.18

Stack Uptimes

  • reality_shift_1:35.19%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:302916
  • name:Reality Shift
  • tooltip:
  • description:$?a302961[Your movement speed is increased by {$302961s1=5}%, and when][When] you move more than {$s1=25} yds within {$s4=4} sec, gain {$s2=194} $?a162700[Agility]?a162702[Strength]?a162697[Agility]?a162698[Strength]?a162699[Intellect]?a162701[Intellect][primary stat] for {$302952d=15 seconds}. This can only occur once every {$302953d=30 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Solar Empowerment 24.6 51.6 12.0sec 3.9sec 85.46% 79.65% 0.3(0.3) 0.0

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:28.14%
  • solar_empowerment_2:39.49%
  • solar_empowerment_3:17.83%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starlord 15.2 45.7 20.3sec 4.9sec 97.06% 92.01% 15.8(15.8) 11.3

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:14.83%
  • starlord_2:22.30%
  • starlord_3:59.92%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.3 1.2 61.1sec 45.5sec 23.60% 0.00% 1.2(1.2) 4.0

Buff details

  • buff initial source:ripple in space
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.60%

Trigger Attempt Success

  • trigger_pct:99.98%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
ripple in space
starsurge Astral Power 60.9 2434.9 40.0 40.0 1693.9
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 93.37 746.88 (31.15%) 8.00 0.05 0.01%
celestial_alignment Astral Power 2.00 80.00 (3.34%) 40.00 0.00 0.00%
sunfire Astral Power 18.04 54.11 (2.26%) 3.00 0.00 0.00%
shooting_stars Astral Power 44.42 177.68 (7.41%) 4.00 0.01 0.01%
moonfire Astral Power 14.03 42.08 (1.76%) 3.00 0.00 0.00%
stellar_flare Astral Power 12.74 101.92 (4.25%) 8.00 0.00 0.00%
lunar_strike Astral Power 76.66 919.85 (38.37%) 12.00 0.06 0.01%
natures_balance Astral Power 400.01 200.00 (8.34%) 0.50 0.00 0.00%
arcanic_pulsar Astral Power 6.24 74.90 (3.12%) 12.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 8.00 8.13
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 20.18 0.00 77.00
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data ripple in space Fight Length
Count 15384
Mean 299.63
Minimum 240.01
Maximum 359.99
Spread ( max - min ) 119.97
Range [ ( max - min ) / 2 * 100% ] 20.02%
DPS
Sample Data ripple in space Damage Per Second
Count 15384
Mean 40720.31
Minimum 36839.23
Maximum 45754.57
Spread ( max - min ) 8915.34
Range [ ( max - min ) / 2 * 100% ] 10.95%
Standard Deviation 1252.6716
5th Percentile 38745.68
95th Percentile 42850.68
( 95th Percentile - 5th Percentile ) 4105.00
Mean Distribution
Standard Deviation 10.0996
95.00% Confidence Intervall ( 40700.52 - 40740.11 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 37
0.1% Error 3636
0.1 Scale Factor Error with Delta=300 13396
0.05 Scale Factor Error with Delta=300 53582
0.01 Scale Factor Error with Delta=300 1339548
Priority Target DPS
Sample Data ripple in space Priority Target Damage Per Second
Count 15384
Mean 40720.31
Minimum 36839.23
Maximum 45754.57
Spread ( max - min ) 8915.34
Range [ ( max - min ) / 2 * 100% ] 10.95%
Standard Deviation 1252.6716
5th Percentile 38745.68
95th Percentile 42850.68
( 95th Percentile - 5th Percentile ) 4105.00
Mean Distribution
Standard Deviation 10.0996
95.00% Confidence Intervall ( 40700.52 - 40740.11 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 37
0.1% Error 3636
0.1 Scale Factor Error with Delta=300 13396
0.05 Scale Factor Error with Delta=300 53582
0.01 Scale Factor Error with Delta=300 1339548
DPS(e)
Sample Data ripple in space Damage Per Second (Effective)
Count 15384
Mean 40720.31
Minimum 36839.23
Maximum 45754.57
Spread ( max - min ) 8915.34
Range [ ( max - min ) / 2 * 100% ] 10.95%
Damage
Sample Data ripple in space Damage
Count 15384
Mean 12174662.29
Minimum 9372785.30
Maximum 15274991.08
Spread ( max - min ) 5902205.77
Range [ ( max - min ) / 2 * 100% ] 24.24%
DTPS
Sample Data ripple in space Damage Taken Per Second
Count 15384
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data ripple in space Healing Per Second
Count 15384
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data ripple in space Healing Per Second (Effective)
Count 15384
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data ripple in space Heal
Count 15384
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data ripple in space Healing Taken Per Second
Count 15384
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data ripple in space Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data ripple in spaceTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data ripple in space Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
E 1.00 potion,if=buff.ca_inc.remains>6&active_enemies=1
0.00 potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
0.00 blood_fury,if=buff.ca_inc.up
F 2.00 berserking,if=buff.ca_inc.up
0.00 arcane_torrent,if=buff.ca_inc.up
0.00 lights_judgment,if=buff.ca_inc.up
0.00 fireblood,if=buff.ca_inc.up
0.00 ancestral_call,if=buff.ca_inc.up
0.00 use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
0.00 use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
0.00 use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
0.00 use_item,name=tidestorm_codex,if=equipped.165576
G 2.94 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams
0.00 purifying_blast
H 5.47 ripple_in_space
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
I 2.00 celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
0.00 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
J 2.94 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
0.00 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
K 60.87 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
L 3.00 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
M 2.80 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
N 14.59 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
O 11.23 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
P 12.74 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
Q 77.02 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
R 92.62 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
S 0.45 sunfire

Sample Sequence

0123456789ACDHKONPIFGKRKRQKRQRQKRQNRQORQJKRKPRQKQQRRQRRRKNKRQRQRJKKOQRKRPQQKRNQQRRRRKHKOQQKRQNPRRRQRJKRKRKRQOKQNQQKRPQRKQRKQRONQKRQRRRRQKKHPRKRGLQKOQQQRQRQJKKQQNKPRQKRQOQKRQRRKNQQRKPRQKRMQQRRRNKKHQQRIEFKRQKPRQORQNJKRKRQKRQLQQRRRKRPRJKRMQKQNQKRQRKRQQQKOPRHKNRGQKRQQQRRRRKKNRQKPRMQKQQKRQQRRQKRKRQ

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask ripple in space 58.0/100: 58% astral_power
Pre precombat 1 food ripple in space 58.0/100: 58% astral_power
Pre precombat 2 augmentation ripple in space 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 9 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power battle_potion_of_intellect
0:00.000 default H ripple_in_space Fluffy_Pillow 66.0/100: 66% astral_power battle_potion_of_intellect
0:01.239 default K starsurge Fluffy_Pillow 66.5/100: 67% astral_power bloodlust, battle_potion_of_intellect
0:02.192 default O moonfire Fluffy_Pillow 27.0/100: 27% astral_power bloodlust, reality_shift, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:03.117 default N sunfire Fluffy_Pillow 31.0/100: 31% astral_power bloodlust, reality_shift, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:04.043 default P stellar_flare Fluffy_Pillow 34.5/100: 35% astral_power bloodlust, reality_shift, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:04.968 default I celestial_alignment Fluffy_Pillow 43.0/100: 43% astral_power bloodlust, reality_shift, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:05.773 default F berserking Fluffy_Pillow 83.5/100: 84% astral_power bloodlust, reality_shift, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:05.773 default G use_items Fluffy_Pillow 83.5/100: 84% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:05.773 default K starsurge Fluffy_Pillow 83.5/100: 84% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect, ignition_mages_fuse
0:06.529 default R solar_wrath Fluffy_Pillow 44.0/100: 44% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), battle_potion_of_intellect, ignition_mages_fuse
0:07.282 default K starsurge Fluffy_Pillow 56.5/100: 56% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), battle_potion_of_intellect, ignition_mages_fuse
0:08.038 default R solar_wrath Fluffy_Pillow 17.0/100: 17% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse
0:08.793 default Q lunar_strike Fluffy_Pillow 29.5/100: 30% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse
0:09.638 default K starsurge Fluffy_Pillow 42.0/100: 42% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse
0:10.394 default R solar_wrath Fluffy_Pillow 2.5/100: 3% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.148 default Q lunar_strike Fluffy_Pillow 11.0/100: 11% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.956 default R solar_wrath Fluffy_Pillow 23.5/100: 24% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.711 default Q lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), starlord(3), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.521 default K starsurge Fluffy_Pillow 45.0/100: 45% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), starlord(3), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(2)
0:14.275 default R solar_wrath Fluffy_Pillow 5.5/100: 6% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.028 default Q lunar_strike Fluffy_Pillow 18.0/100: 18% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.807 default N sunfire Fluffy_Pillow 30.5/100: 31% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.562 default R solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.316 default Q lunar_strike Fluffy_Pillow 46.5/100: 47% astral_power bloodlust, berserking, reality_shift, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(3)
0:18.093 default O moonfire Fluffy_Pillow 59.0/100: 59% astral_power bloodlust, reality_shift, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(4)
0:18.848 default R solar_wrath Fluffy_Pillow 62.5/100: 63% astral_power bloodlust, reality_shift, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.602 default Q lunar_strike Fluffy_Pillow 75.0/100: 75% astral_power bloodlust, reality_shift, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.427 default J cancel_buff Fluffy_Pillow 91.5/100: 92% astral_power bloodlust, reality_shift, arcanic_pulsar(5), celestial_alignment, starlord(3), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.427 default K starsurge Fluffy_Pillow 91.5/100: 92% astral_power bloodlust, reality_shift, arcanic_pulsar(5), celestial_alignment, conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.182 default R solar_wrath Fluffy_Pillow 52.0/100: 52% astral_power bloodlust, reality_shift, arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.936 default K starsurge Fluffy_Pillow 60.5/100: 61% astral_power bloodlust, reality_shift, arcanic_pulsar(6), celestial_alignment, lunar_empowerment, starlord, conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(5)
0:22.690 default P stellar_flare Fluffy_Pillow 21.0/100: 21% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), conch_of_dark_whispers, battle_potion_of_intellect, ignition_mages_fuse(5)
0:23.444 default R solar_wrath Fluffy_Pillow 29.5/100: 30% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), conch_of_dark_whispers, ignition_mages_fuse(5)
0:24.198 default Q lunar_strike Fluffy_Pillow 38.0/100: 38% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), starlord(2), conch_of_dark_whispers, ignition_mages_fuse(5)
0:25.015 default K starsurge Fluffy_Pillow 54.5/100: 55% astral_power bloodlust, arcanic_pulsar(7), lunar_empowerment, starlord(2), conch_of_dark_whispers, ignition_mages_fuse(5)
0:25.769 default Q lunar_strike Fluffy_Pillow 15.0/100: 15% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment, starlord(3), conch_of_dark_whispers, ignition_mages_fuse(5)
0:26.682 default Q lunar_strike Fluffy_Pillow 27.5/100: 28% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers
0:27.795 default R solar_wrath Fluffy_Pillow 40.5/100: 41% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment(2), starlord(3), conch_of_dark_whispers
0:28.551 default R solar_wrath Fluffy_Pillow 49.0/100: 49% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment, starlord(3), conch_of_dark_whispers
0:29.304 default Q lunar_strike Fluffy_Pillow 57.5/100: 57% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, starlord(3), conch_of_dark_whispers
0:30.419 default R solar_wrath Fluffy_Pillow 70.0/100: 70% astral_power bloodlust, arcanic_pulsar(8), starlord(3), conch_of_dark_whispers
0:31.294 default R solar_wrath Fluffy_Pillow 78.5/100: 79% astral_power bloodlust, arcanic_pulsar(8), starlord(3), conch_of_dark_whispers
0:32.168 default R solar_wrath Fluffy_Pillow 87.0/100: 87% astral_power bloodlust, arcanic_pulsar(8), starlord(3), overwhelming_power(24), conch_of_dark_whispers
0:32.971 default K starsurge Fluffy_Pillow 95.5/100: 96% astral_power bloodlust, arcanic_pulsar(8), starlord(3), overwhelming_power(24), conch_of_dark_whispers
0:33.774 default N sunfire Fluffy_Pillow 68.5/100: 69% astral_power bloodlust, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(23), conch_of_dark_whispers
0:34.529 default K starsurge Fluffy_Pillow 80.0/100: 80% astral_power bloodlust, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(22), conch_of_dark_whispers
0:35.282 default R solar_wrath Fluffy_Pillow 40.5/100: 41% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(21), conch_of_dark_whispers
0:36.037 default Q lunar_strike Fluffy_Pillow 53.0/100: 53% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(20), conch_of_dark_whispers
0:36.940 default R solar_wrath Fluffy_Pillow 65.5/100: 66% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(20), conch_of_dark_whispers
0:37.695 default Q lunar_strike Fluffy_Pillow 74.0/100: 74% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(25), conch_of_dark_whispers
0:38.582 default R solar_wrath Fluffy_Pillow 86.5/100: 87% astral_power bloodlust, arcanic_pulsar, celestial_alignment, starlord(3), torrent_of_elements, overwhelming_power(24), conch_of_dark_whispers
0:39.335 default J cancel_buff Fluffy_Pillow 95.0/100: 95% astral_power bloodlust, arcanic_pulsar, celestial_alignment, starlord(3), torrent_of_elements, overwhelming_power(23), conch_of_dark_whispers
0:39.335 default K starsurge Fluffy_Pillow 95.0/100: 95% astral_power bloodlust, arcanic_pulsar, celestial_alignment, torrent_of_elements, overwhelming_power(23), conch_of_dark_whispers
0:40.099 default K starsurge Fluffy_Pillow 55.5/100: 56% astral_power bloodlust, arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(22), conch_of_dark_whispers
0:40.953 default O moonfire Fluffy_Pillow 16.0/100: 16% astral_power bloodlust, arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(22), conch_of_dark_whispers
0:41.786 default Q lunar_strike Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(21), conch_of_dark_whispers
0:43.167 default R solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord(2), torrent_of_elements, overwhelming_power(25), conch_of_dark_whispers
0:44.075 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(24)
0:45.148 default R solar_wrath Fluffy_Pillow 2.0/100: 2% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(23)
0:46.037 default P stellar_flare Fluffy_Pillow 10.5/100: 11% astral_power arcanic_pulsar(4), lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(22)
0:47.087 default Q lunar_strike Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar(4), lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(21)
0:48.428 default Q lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(20)
0:49.776 default K starsurge Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(19)
0:50.839 default R solar_wrath Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(18)
0:51.743 default N sunfire Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(17)
0:52.812 default Q lunar_strike Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(16)
0:54.178 default Q lunar_strike Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(14)
0:55.553 default R solar_wrath Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), overwhelming_power(13)
0:56.476 default R solar_wrath Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), overwhelming_power(12)
0:57.399 default R solar_wrath Fluffy_Pillow 61.0/100: 61% astral_power arcanic_pulsar(5), starlord(3), overwhelming_power(11)
0:58.491 default R solar_wrath Fluffy_Pillow 77.5/100: 78% astral_power arcanic_pulsar(5), starlord(3), overwhelming_power(10)
0:59.588 default K starsurge Fluffy_Pillow 86.5/100: 87% astral_power arcanic_pulsar(5), overwhelming_power(9)
1:00.787 default H ripple_in_space Fluffy_Pillow 55.5/100: 56% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(8)
1:01.954 default K starsurge Fluffy_Pillow 56.0/100: 56% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(7)
1:03.127 default O moonfire Fluffy_Pillow 17.0/100: 17% astral_power reality_shift, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(5)
1:04.275 default Q lunar_strike Fluffy_Pillow 20.5/100: 21% astral_power reality_shift, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(4)
1:05.742 default Q lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power reality_shift, arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(3)
1:07.213 default K starsurge Fluffy_Pillow 46.5/100: 47% astral_power reality_shift, arcanic_pulsar(7), solar_empowerment(2), starlord(2), overwhelming_power(24)
1:08.284 default R solar_wrath Fluffy_Pillow 7.5/100: 8% astral_power reality_shift, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(23)
1:09.171 default Q lunar_strike Fluffy_Pillow 16.0/100: 16% astral_power reality_shift, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(22)
1:10.509 default N sunfire Fluffy_Pillow 29.0/100: 29% astral_power reality_shift, arcanic_pulsar(8), solar_empowerment(2), starlord(3), overwhelming_power(21)
1:11.560 default P stellar_flare Fluffy_Pillow 36.5/100: 37% astral_power reality_shift, arcanic_pulsar(8), solar_empowerment(2), starlord(3), overwhelming_power(20)
1:12.617 default R solar_wrath Fluffy_Pillow 45.0/100: 45% astral_power reality_shift, arcanic_pulsar(8), solar_empowerment(2), starlord(3), overwhelming_power(19)
1:13.518 default R solar_wrath Fluffy_Pillow 54.0/100: 54% astral_power reality_shift, arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(18)
1:14.424 default R solar_wrath Fluffy_Pillow 62.5/100: 63% astral_power reality_shift, arcanic_pulsar(8), starlord(3), overwhelming_power(17)
1:15.492 default Q lunar_strike Fluffy_Pillow 71.0/100: 71% astral_power reality_shift, arcanic_pulsar(8), lunar_empowerment, starlord(3), overwhelming_power(16)
1:16.859 default R solar_wrath Fluffy_Pillow 84.0/100: 84% astral_power reality_shift, arcanic_pulsar(8), starlord(3), overwhelming_power(15)
1:17.936 default J cancel_buff Fluffy_Pillow 96.5/100: 97% astral_power reality_shift, arcanic_pulsar(8), starlord(3), overwhelming_power(14)
1:17.936 default K starsurge Fluffy_Pillow 96.5/100: 97% astral_power reality_shift, arcanic_pulsar(8), overwhelming_power(14)
1:19.113 default R solar_wrath Fluffy_Pillow 69.5/100: 70% astral_power reality_shift, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(12)
1:19.965 default K starsurge Fluffy_Pillow 82.0/100: 82% astral_power reality_shift, celestial_alignment, lunar_empowerment, starlord, overwhelming_power(12)
1:20.965 default R solar_wrath Fluffy_Pillow 42.5/100: 43% astral_power reality_shift, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(11)
1:21.795 default K starsurge Fluffy_Pillow 51.5/100: 52% astral_power reality_shift, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), overwhelming_power(10)
1:22.776 default R solar_wrath Fluffy_Pillow 12.0/100: 12% astral_power reality_shift, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(9)
1:23.590 default Q lunar_strike Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(8)
1:24.813 default O moonfire Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(2), lunar_empowerment(2), starlord(3), overwhelming_power(7)
1:25.920 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(2), lunar_empowerment(2), starlord(3), overwhelming_power(6)
1:27.031 default Q lunar_strike Fluffy_Pillow 2.0/100: 2% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(4)
1:28.456 default N sunfire Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(3)
1:29.580 default Q lunar_strike Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(2)
1:31.019 default Q lunar_strike Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3)
1:32.466 default K starsurge Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3)
1:33.602 default R solar_wrath Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3)
1:34.569 default P stellar_flare Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers
1:35.705 default Q lunar_strike Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers
1:37.153 default R solar_wrath Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), conch_of_dark_whispers
1:38.119 default K starsurge Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(4), solar_empowerment, conch_of_dark_whispers
1:39.357 default Q lunar_strike Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord, conch_of_dark_whispers
1:40.889 default R solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord, conch_of_dark_whispers
1:41.911 default K starsurge Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord, conch_of_dark_whispers
1:43.114 default Q lunar_strike Fluffy_Pillow 3.5/100: 4% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(2), conch_of_dark_whispers
1:44.603 default R solar_wrath Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(2), conch_of_dark_whispers
1:45.597 default O moonfire Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), conch_of_dark_whispers
1:46.764 default N sunfire Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), conch_of_dark_whispers
1:47.935 default Q lunar_strike Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), conch_of_dark_whispers
1:49.425 default K starsurge Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(2), conch_of_dark_whispers
1:50.593 default R solar_wrath Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(3)
1:51.562 default Q lunar_strike Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3)
1:53.010 default R solar_wrath Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(7), solar_empowerment(3), starlord(3)
1:53.976 default R solar_wrath Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3)
1:54.944 default R solar_wrath Fluffy_Pillow 65.5/100: 66% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3)
1:55.909 default R solar_wrath Fluffy_Pillow 74.0/100: 74% astral_power arcanic_pulsar(7), starlord(3)
1:57.045 default Q lunar_strike Fluffy_Pillow 83.0/100: 83% astral_power arcanic_pulsar(7), lunar_empowerment, starlord(3)
1:58.493 default K starsurge Fluffy_Pillow 99.5/100: 100% astral_power arcanic_pulsar(7)
1:59.731 default K starsurge Fluffy_Pillow 60.5/100: 61% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord
2:00.934 default H ripple_in_space Fluffy_Pillow 33.5/100: 34% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2)
2:01.949 default P stellar_flare Fluffy_Pillow 34.0/100: 34% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2)
2:02.966 default R solar_wrath Fluffy_Pillow 42.5/100: 43% astral_power reality_shift, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2)
2:03.830 default K starsurge Fluffy_Pillow 51.5/100: 52% astral_power reality_shift, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2)
2:04.845 default R solar_wrath Fluffy_Pillow 12.0/100: 12% astral_power reality_shift, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3)
2:05.687 default G use_items Fluffy_Pillow 20.5/100: 21% astral_power reality_shift, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3)
2:05.687 default L sunfire Fluffy_Pillow 20.5/100: 21% astral_power reality_shift, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), ignition_mages_fuse
2:06.634 default Q lunar_strike Fluffy_Pillow 24.0/100: 24% astral_power reality_shift, arcanic_pulsar, lunar_empowerment(3), solar_empowerment, starlord(3), ignition_mages_fuse
2:08.020 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power reality_shift, arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord(3), ignition_mages_fuse
2:09.111 default O moonfire Fluffy_Pillow 6.0/100: 6% astral_power reality_shift, arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment(2), starlord(3), ignition_mages_fuse
2:10.199 default Q lunar_strike Fluffy_Pillow 9.5/100: 10% astral_power reality_shift, arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment(2), starlord(3), ignition_mages_fuse(2)
2:11.531 default Q lunar_strike Fluffy_Pillow 22.5/100: 23% astral_power reality_shift, arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), ignition_mages_fuse(2)
2:12.862 default Q lunar_strike Fluffy_Pillow 35.5/100: 36% astral_power reality_shift, arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), ignition_mages_fuse(2)
2:14.191 default R solar_wrath Fluffy_Pillow 48.0/100: 48% astral_power reality_shift, arcanic_pulsar(2), solar_empowerment(2), starlord(3), ignition_mages_fuse(3)
2:15.044 default Q lunar_strike Fluffy_Pillow 57.0/100: 57% astral_power reality_shift, arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3), ignition_mages_fuse(3)
2:16.322 default R solar_wrath Fluffy_Pillow 69.5/100: 70% astral_power reality_shift, arcanic_pulsar(2), solar_empowerment, starlord(3), ignition_mages_fuse(3)
2:17.175 default Q lunar_strike Fluffy_Pillow 78.0/100: 78% astral_power reality_shift, arcanic_pulsar(2), lunar_empowerment, starlord(3), ignition_mages_fuse(3)
2:18.454 default J cancel_buff Fluffy_Pillow 91.0/100: 91% astral_power reality_shift, arcanic_pulsar(2), starlord(3), overwhelming_power(25), ignition_mages_fuse(4)
2:18.454 default K starsurge Fluffy_Pillow 91.0/100: 91% astral_power reality_shift, arcanic_pulsar(2), overwhelming_power(25), ignition_mages_fuse(4)
2:19.429 default K starsurge Fluffy_Pillow 51.5/100: 52% astral_power reality_shift, arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(24), ignition_mages_fuse(4)
2:20.379 default Q lunar_strike Fluffy_Pillow 12.5/100: 13% astral_power reality_shift, arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(23), ignition_mages_fuse(4)
2:21.558 default Q lunar_strike Fluffy_Pillow 25.0/100: 25% astral_power reality_shift, arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(22), ignition_mages_fuse(4)
2:22.740 default N sunfire Fluffy_Pillow 38.0/100: 38% astral_power reality_shift, arcanic_pulsar(4), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(21), ignition_mages_fuse(5)
2:23.640 default K starsurge Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(20), ignition_mages_fuse(5)
2:24.542 default P stellar_flare Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(19), ignition_mages_fuse(5)
2:25.423 default R solar_wrath Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(18), ignition_mages_fuse(5)
2:26.177 default Q lunar_strike Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(17)
2:27.538 default K starsurge Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(16)
2:28.609 default R solar_wrath Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(15)
2:29.524 default Q lunar_strike Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(14)
2:30.900 default O moonfire Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(13)
2:31.983 default Q lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(12)
2:33.368 default K starsurge Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(10)
2:34.462 default R solar_wrath Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(9)
2:35.395 default Q lunar_strike Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(8)
2:36.799 default R solar_wrath Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(7), solar_empowerment(3), starlord(3), overwhelming_power(7)
2:37.741 default R solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), overwhelming_power(6)
2:38.685 default K starsurge Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, overwhelming_power(5)
2:39.900 default N sunfire Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord, overwhelming_power(4)
2:41.084 default Q lunar_strike Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord, overwhelming_power(2)
2:42.605 default Q lunar_strike Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power
2:44.132 default R solar_wrath Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord
2:45.154 default K starsurge Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(8), solar_empowerment, starlord
2:46.358 default P stellar_flare Fluffy_Pillow 18.5/100: 19% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2)
2:47.375 default R solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2)
2:48.239 default Q lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2)
2:49.533 default K starsurge Fluffy_Pillow 49.0/100: 49% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2)
2:50.550 default R solar_wrath Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3)
2:51.391 default M moonfire Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3)
2:52.379 default Q lunar_strike Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(25)
2:53.704 default Q lunar_strike Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(24)
2:55.031 default R solar_wrath Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar, solar_empowerment, starlord(3), overwhelming_power(22)
2:55.925 default R solar_wrath Fluffy_Pillow 60.0/100: 60% astral_power arcanic_pulsar, starlord(3), overwhelming_power(22)
2:56.977 default R solar_wrath Fluffy_Pillow 72.5/100: 73% astral_power arcanic_pulsar, starlord(3), overwhelming_power(21)
2:58.029 default N sunfire Fluffy_Pillow 81.5/100: 82% astral_power arcanic_pulsar, starlord(3), overwhelming_power(19)
2:59.092 default K starsurge Fluffy_Pillow 85.0/100: 85% astral_power arcanic_pulsar, overwhelming_power(18)
3:00.252 default K starsurge Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(17)
3:01.382 default H ripple_in_space Fluffy_Pillow 6.5/100: 7% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(16)
3:02.484 default Q lunar_strike Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(15)
3:03.893 default Q lunar_strike Fluffy_Pillow 20.5/100: 21% astral_power reality_shift, arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(14)
3:05.306 default R solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power reality_shift, arcanic_pulsar(3), solar_empowerment(2), starlord(2), overwhelming_power(12)
3:06.257 default I celestial_alignment Fluffy_Pillow 42.0/100: 42% astral_power reality_shift, arcanic_pulsar(3), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(11)
3:07.234 default E potion Fluffy_Pillow 82.5/100: 83% astral_power reality_shift, arcanic_pulsar(3), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(10)
3:07.234 default F berserking Fluffy_Pillow 82.5/100: 83% astral_power reality_shift, arcanic_pulsar(3), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(10), battle_potion_of_intellect
3:07.234 default K starsurge Fluffy_Pillow 82.5/100: 83% astral_power berserking, reality_shift, arcanic_pulsar(3), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(10), battle_potion_of_intellect
3:08.125 default R solar_wrath Fluffy_Pillow 43.0/100: 43% astral_power berserking, reality_shift, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(9), battle_potion_of_intellect
3:08.879 default Q lunar_strike Fluffy_Pillow 51.5/100: 52% astral_power berserking, reality_shift, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(9), battle_potion_of_intellect
3:09.990 default K starsurge Fluffy_Pillow 64.5/100: 65% astral_power berserking, reality_shift, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(8), battle_potion_of_intellect
3:10.863 default P stellar_flare Fluffy_Pillow 25.0/100: 25% astral_power berserking, reality_shift, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(7), battle_potion_of_intellect
3:11.738 default R solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power berserking, reality_shift, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(6), battle_potion_of_intellect
3:12.493 default Q lunar_strike Fluffy_Pillow 46.0/100: 46% astral_power berserking, reality_shift, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(5), battle_potion_of_intellect
3:13.619 default O moonfire Fluffy_Pillow 59.0/100: 59% astral_power berserking, reality_shift, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(4), battle_potion_of_intellect
3:14.507 default R solar_wrath Fluffy_Pillow 62.5/100: 63% astral_power berserking, reality_shift, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(3), conch_of_dark_whispers, battle_potion_of_intellect
3:15.263 default Q lunar_strike Fluffy_Pillow 71.0/100: 71% astral_power berserking, reality_shift, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(2), conch_of_dark_whispers, battle_potion_of_intellect
3:16.398 default N sunfire Fluffy_Pillow 87.5/100: 88% astral_power berserking, reality_shift, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power, conch_of_dark_whispers, battle_potion_of_intellect
3:17.292 default J cancel_buff Fluffy_Pillow 91.5/100: 92% astral_power berserking, reality_shift, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, conch_of_dark_whispers, battle_potion_of_intellect
3:17.292 default K starsurge Fluffy_Pillow 91.5/100: 92% astral_power berserking, reality_shift, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, solar_empowerment, torrent_of_elements, conch_of_dark_whispers, battle_potion_of_intellect
3:18.271 default R solar_wrath Fluffy_Pillow 52.0/100: 52% astral_power berserking, reality_shift, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord, torrent_of_elements, conch_of_dark_whispers, battle_potion_of_intellect
3:19.078 default K starsurge Fluffy_Pillow 64.5/100: 65% astral_power berserking, reality_shift, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements, conch_of_dark_whispers, battle_potion_of_intellect
3:20.029 default R solar_wrath Fluffy_Pillow 25.0/100: 25% astral_power reality_shift, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), torrent_of_elements, conch_of_dark_whispers, battle_potion_of_intellect
3:20.893 default Q lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power reality_shift, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), torrent_of_elements, conch_of_dark_whispers, battle_potion_of_intellect
3:22.187 default K starsurge Fluffy_Pillow 50.5/100: 51% astral_power reality_shift, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements, conch_of_dark_whispers, battle_potion_of_intellect
3:23.205 default R solar_wrath Fluffy_Pillow 11.0/100: 11% astral_power reality_shift, arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), conch_of_dark_whispers, battle_potion_of_intellect
3:24.045 default Q lunar_strike Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), conch_of_dark_whispers, battle_potion_of_intellect
3:25.304 default L sunfire Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), conch_of_dark_whispers, battle_potion_of_intellect
3:26.293 default Q lunar_strike Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment, starlord(3), conch_of_dark_whispers, battle_potion_of_intellect
3:27.740 default Q lunar_strike Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), conch_of_dark_whispers, battle_potion_of_intellect
3:29.187 default R solar_wrath Fluffy_Pillow 62.0/100: 62% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), battle_potion_of_intellect
3:30.153 default R solar_wrath Fluffy_Pillow 71.0/100: 71% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), battle_potion_of_intellect
3:31.119 default R solar_wrath Fluffy_Pillow 79.5/100: 80% astral_power arcanic_pulsar(8), starlord(3), battle_potion_of_intellect
3:32.254 default K starsurge Fluffy_Pillow 88.5/100: 89% astral_power arcanic_pulsar(8), starlord(3)
3:33.389 default R solar_wrath Fluffy_Pillow 65.0/100: 65% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3)
3:34.229 default P stellar_flare Fluffy_Pillow 73.5/100: 74% astral_power celestial_alignment, lunar_empowerment, starlord(3)
3:35.219 default R solar_wrath Fluffy_Pillow 82.0/100: 82% astral_power celestial_alignment, lunar_empowerment, starlord(3)
3:36.208 default J cancel_buff Fluffy_Pillow 91.0/100: 91% astral_power celestial_alignment, lunar_empowerment, starlord(3)
3:36.208 default K starsurge Fluffy_Pillow 91.0/100: 91% astral_power celestial_alignment, lunar_empowerment
3:37.285 default R solar_wrath Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord
3:38.175 default M moonfire Fluffy_Pillow 60.0/100: 60% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord
3:39.221 default Q lunar_strike Fluffy_Pillow 64.0/100: 64% astral_power arcanic_pulsar, lunar_empowerment(3), starlord
3:40.753 default K starsurge Fluffy_Pillow 77.0/100: 77% astral_power arcanic_pulsar, lunar_empowerment(2), starlord
3:41.956 default Q lunar_strike Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord(2)
3:43.446 default N sunfire Fluffy_Pillow 54.5/100: 55% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(2)
3:44.616 default Q lunar_strike Fluffy_Pillow 58.5/100: 59% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(2)
3:46.104 default K starsurge Fluffy_Pillow 71.5/100: 72% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(2)
3:47.273 default R solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(3)
3:48.240 default Q lunar_strike Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3)
3:49.687 default R solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord(3)
3:50.652 default K starsurge Fluffy_Pillow 66.5/100: 67% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3)
3:51.789 default R solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3)
3:52.755 default Q lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(4), lunar_empowerment(3), solar_empowerment(2), starlord(3)
3:54.204 default Q lunar_strike Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3)
3:55.652 default Q lunar_strike Fluffy_Pillow 62.0/100: 62% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3)
3:57.100 default K starsurge Fluffy_Pillow 75.0/100: 75% astral_power arcanic_pulsar(4), solar_empowerment(2)
3:58.338 default O moonfire Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord
3:59.542 default P stellar_flare Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord
4:00.745 default R solar_wrath Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord
4:01.769 default H ripple_in_space Fluffy_Pillow 57.0/100: 57% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord
4:02.971 default K starsurge Fluffy_Pillow 57.5/100: 57% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord
4:04.175 default N sunfire Fluffy_Pillow 18.5/100: 19% astral_power reality_shift, arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(2)
4:05.343 default R solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power reality_shift, arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord(2), conch_of_dark_whispers
4:06.335 default G use_items Fluffy_Pillow 31.0/100: 31% astral_power reality_shift, arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(2), conch_of_dark_whispers
4:06.335 default Q lunar_strike Fluffy_Pillow 31.0/100: 31% astral_power reality_shift, arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord(2), conch_of_dark_whispers, ignition_mages_fuse
4:07.761 default K starsurge Fluffy_Pillow 44.0/100: 44% astral_power reality_shift, arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), conch_of_dark_whispers, ignition_mages_fuse
4:08.879 default R solar_wrath Fluffy_Pillow 4.5/100: 5% astral_power reality_shift, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(3), conch_of_dark_whispers, ignition_mages_fuse
4:09.804 default Q lunar_strike Fluffy_Pillow 13.5/100: 14% astral_power reality_shift, arcanic_pulsar(7), lunar_empowerment(3), solar_empowerment(2), starlord(3), conch_of_dark_whispers, ignition_mages_fuse
4:11.191 default Q lunar_strike Fluffy_Pillow 26.0/100: 26% astral_power reality_shift, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(3), conch_of_dark_whispers, ignition_mages_fuse(2)
4:12.521 default Q lunar_strike Fluffy_Pillow 43.0/100: 43% astral_power reality_shift, arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), conch_of_dark_whispers, ignition_mages_fuse(2)
4:13.853 default R solar_wrath Fluffy_Pillow 56.0/100: 56% astral_power reality_shift, arcanic_pulsar(7), solar_empowerment(3), starlord(3), conch_of_dark_whispers, ignition_mages_fuse(2)
4:14.740 default R solar_wrath Fluffy_Pillow 64.5/100: 65% astral_power reality_shift, arcanic_pulsar(7), solar_empowerment(2), starlord(3), conch_of_dark_whispers, ignition_mages_fuse(3)
4:15.593 default R solar_wrath Fluffy_Pillow 73.0/100: 73% astral_power reality_shift, arcanic_pulsar(7), solar_empowerment, starlord(3), conch_of_dark_whispers, ignition_mages_fuse(3)
4:16.446 default R solar_wrath Fluffy_Pillow 85.5/100: 86% astral_power reality_shift, arcanic_pulsar(7), starlord(3), conch_of_dark_whispers, ignition_mages_fuse(3)
4:17.449 default K starsurge Fluffy_Pillow 94.5/100: 95% astral_power reality_shift, arcanic_pulsar(7), lunar_empowerment, conch_of_dark_whispers, ignition_mages_fuse(3)
4:18.542 default K starsurge Fluffy_Pillow 55.0/100: 55% astral_power reality_shift, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment, starlord, conch_of_dark_whispers, ignition_mages_fuse(4)
4:19.565 default N sunfire Fluffy_Pillow 28.0/100: 28% astral_power reality_shift, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(25), ignition_mages_fuse(4)
4:20.365 default R solar_wrath Fluffy_Pillow 31.5/100: 32% astral_power reality_shift, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(24), ignition_mages_fuse(4)
4:21.119 default Q lunar_strike Fluffy_Pillow 40.0/100: 40% astral_power reality_shift, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(23), ignition_mages_fuse(4)
4:22.144 default K starsurge Fluffy_Pillow 56.5/100: 56% astral_power reality_shift, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(22), ignition_mages_fuse(4)
4:22.952 default P stellar_flare Fluffy_Pillow 17.0/100: 17% astral_power reality_shift, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(22), ignition_mages_fuse(5)
4:23.714 default R solar_wrath Fluffy_Pillow 25.5/100: 26% astral_power reality_shift, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(21), ignition_mages_fuse(5)
4:24.469 default M moonfire Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(20), ignition_mages_fuse(5)
4:25.233 default Q lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(19), ignition_mages_fuse(5)
4:26.354 default K starsurge Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(18)
4:27.418 default Q lunar_strike Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(17)
4:28.777 default Q lunar_strike Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(16)
4:30.144 default K starsurge Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(14)
4:31.223 default R solar_wrath Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(13)
4:32.145 default Q lunar_strike Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(12)
4:33.530 default Q lunar_strike Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(11)
4:34.921 default R solar_wrath Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(3), solar_empowerment(3), starlord(3), overwhelming_power(10)
4:35.852 default R solar_wrath Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), overwhelming_power(9)
4:36.786 default Q lunar_strike Fluffy_Pillow 65.5/100: 66% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(8)
4:38.190 default K starsurge Fluffy_Pillow 78.0/100: 78% astral_power arcanic_pulsar(3), solar_empowerment(2), overwhelming_power(6)
4:39.402 default R solar_wrath Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord, overwhelming_power(5)
4:40.405 default K starsurge Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(4)
4:41.589 default R solar_wrath Fluffy_Pillow 12.5/100: 13% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(3)
4:42.571 default Q lunar_strike Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(2)

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 16238 14762 13761
Intellect 1467 -3 13346 11714 9693 (6045)
Spirit 0 0 0 0 0
Health 324760 295240 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 13346 11714 0
Crit 15.68% 15.68% 769
Haste 21.51% 21.51% 1463
Damage / Heal Versatility 4.81% 4.81% 409
ManaReg per Second 2378 640 0
Attack Power 13880 12183 0
Mastery 55.20% 55.20% 2005
Armor 2962 2962 2962
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 447.00
Local Head Hood of the Slithering Loa
ilevel: 450, stats: { 407 Armor, +1145 AgiInt, +2255 Sta }
Local Neck Heart of Azeroth
ilevel: 463, stats: { +325 Haste, +325 Crit, +325 Mastery, +719 Sta, +382 StrAgiInt }
Local Shoulders Gorak Tul's Mantle
ilevel: 450, stats: { 376 Armor, +859 AgiInt, +1691 Sta }
Local Chest Spymaster's Wrap
ilevel: 450, stats: { 501 Armor, +1145 AgiInt, +2255 Sta }
Local Waist Beloved Monarch's Waistwrap
ilevel: 445, stats: { 271 Armor, +431 AgiInt, +789 Sta, +147 Mastery, +82 Crit }
Local Legs Leggings of the Stormborn
ilevel: 445, stats: { 422 Armor, +575 AgiInt, +1053 Sta, +179 Vers, +126 Crit }
Local Feet Ancient Tempest Striders
ilevel: 445, stats: { 331 Armor, +431 AgiInt, +789 Sta, +134 Mastery, +95 Haste }
Local Wrists Tideblood Bracers
ilevel: 445, stats: { 211 Armor, +323 AgiInt, +592 Sta, +105 Haste, +66 Crit }
Local Hands Gloves of Incomparable Beauty
ilevel: 445, stats: { 301 Armor, +431 AgiInt, +789 Sta, +134 Haste, +95 Mastery }
Local Finger1 Boralus Noble's Seal
ilevel: 445, stats: { +592 Sta, +369 Mastery, +169 Haste }, enchant: { +60 Haste }
Local Finger2 Cursed Lover's Ring
ilevel: 445, stats: { +592 Sta, +307 Haste, +230 Vers }, enchant: { +60 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 445, stats: { +546 Int }
Local Trinket2 Conch of Dark Whispers
ilevel: 445, stats: { +546 Int }
Local Back Cloak of Ill Tidings
ilevel: 445, stats: { 142 Armor, +323 StrAgiInt, +592 Sta, +110 Mastery, +61 Crit }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 445, weapon: { 661 - 896, 3.6 }, stats: { +575 Int, +1053 Sta, +109 Haste, +109 Crit, +109 Mastery, +1981 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="ripple in space"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
talents=1000231
azerite_override=lifespeed:450/heed_my_call:450/overwhelming_power:450/streaking_stars:450/streaking_stars:450/streaking_stars:450/arcanic_pulsar:450/loyal_to_the_end:450/loyal_to_the_end:450

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6&active_enemies=1
actions+=/potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
actions+=/blood_fury,if=buff.ca_inc.up
actions+=/berserking,if=buff.ca_inc.up
actions+=/arcane_torrent,if=buff.ca_inc.up
actions+=/lights_judgment,if=buff.ca_inc.up
actions+=/fireblood,if=buff.ca_inc.up
actions+=/ancestral_call,if=buff.ca_inc.up
actions+=/use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
actions+=/use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
actions+=/use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
actions+=/celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=hood_of_the_slithering_loa,id=159318,ilevel=450
neck=heart_of_azeroth,id=158075,ilevel=463
shoulders=gorak_tuls_mantle,id=159339,ilevel=450
back=cloak_of_ill_tidings,id=168391,ilevel=445
chest=spymasters_wrap,id=155860,ilevel=450
wrists=tideblood_bracers,id=168377,ilevel=445
hands=gloves_of_incomparable_beauty,id=168887,ilevel=445
waist=beloved_monarchs_waistwrap,id=168871,ilevel=445
legs=leggings_of_the_stormborn,id=168378,ilevel=445
feet=ancient_tempest_striders,id=168380,ilevel=445
finger1=boralus_nobles_seal,id=168889,ilevel=445,enchant=60haste
finger2=cursed_lovers_ring,id=168891,ilevel=445,enchant=60haste
trinket1=ignition_mages_fuse,id=159615,ilevel=445
trinket2=conch_of_dark_whispers,id=159620,ilevel=445
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=445,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=447.20
# gear_stamina=13761
# gear_intellect=9693
# gear_crit_rating=769
# gear_haste_rating=1364
# gear_mastery_rating=1289
# gear_versatility_rating=409
# gear_armor=2962

unbound force : 41749 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
41748.6 41748.6 19.9 / 0.048% 4891.3 / 11.7% 5114.2
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.1 8.0 Astral Power 0.00% 58.5 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Stellar Flare (Balance Druid)
  • 100: Shooting Stars (Balance Druid)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
unbound force 41749
Heed My Call 309 (441) 0.7% (1.1%) 8.3 32.93sec 15977 0 Direct 8.3 9128 18269 11189 22.5%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.26 8.26 0.00 0.00 0.0000 0.0000 92434.24 92434.24 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.40 77.45% 9128.38 8921 9813 9126.23 0 9813 58406 58406 0.00
crit 1.86 22.55% 18269.37 17842 19626 15614.38 0 19626 34028 34028 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 132 0.3% 8.3 32.93sec 4788 0 Direct 8.3 3912 7828 4788 22.4%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.26 8.26 0.00 0.00 0.0000 0.0000 39553.24 39553.24 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.41 77.64% 3912.46 3823 4206 3911.47 0 4206 25093 25093 0.00
crit 1.85 22.36% 7827.71 7646 8411 6679.56 0 8411 14461 14461 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 5915 14.2% 76.8 3.80sec 23051 17747 Direct 76.8 19049 38012 23051 21.1%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 76.81 76.81 0.00 0.00 1.2988 0.0000 1770600.26 1770600.26 0.00 17747.35 17747.35
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 60.60 78.90% 19048.61 10135 24211 19056.78 18365 20164 1154420 1154420 0.00
crit 16.21 21.10% 38012.25 20270 48422 38026.95 34529 44954 616180 616180 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 2937 7.0% 14.0 21.38sec 62654 61974 Direct 14.0 3281 6544 4011 22.4%  
Periodic 222.8 3024 6024 3691 22.2% 98.9%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.03 14.03 222.83 222.83 1.0110 1.3304 878734.46 878734.46 0.00 2828.88 61974.36
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.89 77.63% 3281.36 2981 4065 3283.49 2981 3609 35728 35728 0.00
crit 3.14 22.37% 6543.66 5963 8130 6351.63 0 8130 20528 20528 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 173.3 77.76% 3023.73 4 3785 3025.16 2938 3169 523947 523947 0.00
crit 49.6 22.24% 6024.08 4 7570 6026.42 5671 6463 298531 298531 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Shooting Stars 945 2.3% 44.5 6.55sec 6356 0 Direct 44.5 5197 10353 6356 22.5%  

Stats details: shooting_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.50 44.50 0.00 0.00 0.0000 0.0000 282818.26 282818.26 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 34.49 77.52% 5196.74 4769 6503 5198.84 4861 5699 179256 179256 0.00
crit 10.00 22.48% 10353.28 9539 13006 10355.95 9539 12272 103562 103562 0.00
 
 

Action details: shooting_stars

Static Values
  • id:202497
  • school:astral
  • resource:none
  • range:50000.0
  • travel_speed:0.8000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating ${$202497m2/10} Astral Power.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.360000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Solar Wrath 3281 (5241) 7.9% (12.6%) 92.8 3.16sec 16895 18840 Direct 93.3 8695 17363 10520 21.1%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 92.83 93.34 0.00 0.00 0.8968 0.0000 981998.43 981998.43 0.00 18840.17 18840.17
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.69 78.94% 8694.70 7949 10838 8699.97 8390 9164 640688 640688 0.00
crit 19.66 21.06% 17362.73 15898 21676 17371.51 15898 19273 341310 341310 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (solar_empowerment) 1960 4.7% 74.0 3.95sec 7922 0 Direct 74.0 7922 0 7922 0.0%  

Stats details: solar_empowerment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 74.02 74.02 0.00 0.00 0.0000 0.0000 586426.58 586426.58 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 74.02 100.00% 7922.39 5962 16257 7926.33 6760 9365 586427 586427 0.00
 
 

Action details: solar_empowerment

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:5961.69
  • base_dd_max:5961.69
  • base_dd_mult:1.00
 
Starsurge 13821 33.1% 61.0 4.94sec 67756 64971 Direct 60.8 55993 111640 67979 21.5%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 61.02 60.82 0.00 0.00 1.0429 0.0000 4134714.60 4134714.60 0.00 64971.39 64971.39
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 47.72 78.46% 55993.21 51347 69612 56018.49 53674 59103 2672152 2672152 0.00
crit 13.10 21.54% 111639.59 102695 139223 111680.51 102695 126588 1462563 1462563 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Stellar Flare 1903 4.6% 12.7 23.57sec 44721 43668 Direct 12.7 2766 5527 3369 21.8%  
Periodic 220.4 1959 3906 2390 22.2% 98.1%

Stats details: stellar_flare

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.74 12.74 220.36 220.36 1.0241 1.3339 569652.49 569652.49 0.00 1855.67 43668.26
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.96 78.17% 2766.39 2570 3504 2767.13 2570 3173 27548 27548 0.00
crit 2.78 21.83% 5527.35 5140 7009 5283.07 0 7009 15367 15367 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 171.5 77.85% 1959.22 3 2453 1960.13 1901 2059 336092 336092 0.00
crit 48.8 22.15% 3905.69 12 4906 3907.16 3668 4211 190646 190646 0.00
 
 

Action details: stellar_flare

Static Values
  • id:202347
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
Spelldata
  • id:202347
  • name:Stellar Flare
  • school:astral
  • tooltip:Suffering $w2 Astral damage every $t2 sec.
  • description:Burns the target for {$s1=0} Astral damage, and then an additional $o2 damage over {$d=24 seconds}. |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.125000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.087500
  • base_td:0.00
  • base_td_mult:0.82
  • dot_duration:24.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Streaking Star (s) 5933 14.1% 89.2 3.11sec 19798 0 Direct 89.2 16388 32781 19798 20.8%  

Stats details: streaking_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 89.18 89.18 0.00 0.00 0.0000 0.0000 1765535.21 1765535.21 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 70.62 79.19% 16387.68 16021 17623 16387.40 16021 17290 1157344 1157344 0.00
crit 18.55 20.81% 32780.59 32042 35246 32781.96 32042 35246 608191 608191 0.00
 
 

Action details: streaking_stars

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 3272 7.8% 18.1 16.48sec 54223 53377 Direct 18.1 4507 8988 5507 22.3%  
Periodic 222.0 3248 6471 3963 22.2% 98.6%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.06 18.06 221.97 221.97 1.0159 1.3316 979102.01 979102.01 0.00 3118.98 53377.42
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.03 77.68% 4507.36 4112 5607 4508.13 4179 4978 63223 63223 0.00
crit 4.03 22.32% 8987.73 8225 11214 8890.45 0 11214 36223 36223 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 172.7 77.81% 3247.65 2 4065 3249.18 3148 3421 560928 560928 0.00
crit 49.3 22.19% 6471.48 16 8130 6474.01 6027 6996 318728 318728 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
The Unbound Force 1340 3.2% 4.9 67.89sec 81644 74015 Periodic 60.2 1594 8206 6681 76.9% 3.3%

Stats details: the_unbound_force

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.92 0.00 39.26 60.15 1.1032 0.2500 401900.69 401900.69 0.00 26366.25 74014.86
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.9 23.06% 1593.94 105 1902 1591.95 1242 1862 22109 22109 0.00
crit 46.3 76.94% 8206.23 524 9509 8206.20 7362 9237 379792 379792 0.00
 
 

Action details: the_unbound_force

Static Values
  • id:298452
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.reckless_force.up|time<5
Spelldata
  • id:298452
  • name:The Unbound Force
  • school:fire
  • tooltip:
  • description:Unleash the forces within the Heart of Azeroth, causing shards of Azerite to strike your target for ${({$298407s3=378}*(({$d=2 seconds}/$t)+1)+{$298407s3=378})} Fire damage over {$d=2 seconds}. This damage is increased by {$s2=300}% if it critically strikes.$?a298456[ Each time The Unbound Force causes a critical strike, it immediately strikes the target with an additional Azerite shard, up to a maximum of $298456m2.][]
Damage Over Time
  • tick_may_crit:false
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • base_td_mult:1.00
  • dot_duration:2.00
  • base_tick_time:0.33
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Action details: the_unbound_force_tick

Static Values
  • id:298453
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:50.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:298453
  • name:The Unbound Force
  • school:fire
  • tooltip:
  • description:{$@spelldesc298452=Unleash the forces within the Heart of Azeroth, causing shards of Azerite to strike your target for ${({$298407s3=378}*(({$d=2 seconds}/$t)+1)+{$298407s3=378})} Fire damage over {$d=2 seconds}. This damage is increased by {$s2=300}% if it critically strikes.$?a298456[ Each time The Unbound Force causes a critical strike, it immediately strikes the target with an additional Azerite shard, up to a maximum of $298456m2.][]}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1571.35
  • base_dd_max:1571.35
  • base_dd_mult:1.00
 
Simple Action Stats Execute Interval
unbound force
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:unbound force
  • harmful:false
  • if_expr:
 
Berserking 2.0 182.65sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.0 182.73sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.9000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:251837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:unbound force
  • harmful:false
  • if_expr:
 
Bountiful Captain's Feast (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:259410
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:unbound force
  • harmful:false
  • if_expr:
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Battle Potion of Intellect (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:279151
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 7.2 53.6 44.2sec 4.9sec 92.76% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:11.53%
  • arcanic_pulsar_2:10.38%
  • arcanic_pulsar_3:11.22%
  • arcanic_pulsar_4:10.63%
  • arcanic_pulsar_5:13.72%
  • arcanic_pulsar_6:10.51%
  • arcanic_pulsar_7:10.74%
  • arcanic_pulsar_8:14.03%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 188.7sec 0.0sec 16.24% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.24%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Battle-Scarred Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Berserking 2.0 0.0 182.6sec 182.6sec 8.12% 7.73% 0.0(0.0) 2.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast) 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Celestial Alignment 8.2 0.0 37.4sec 37.4sec 25.89% 32.54% 0.0(0.0) 8.1

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:25.89%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Conch of Dark Whispers 4.3 1.2 60.7sec 45.5sec 23.66% 0.00% 1.2(1.2) 4.1

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_conch_of_dark_whispers
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Conch of Dark Whispers

Stat Buff details

  • stat:crit_rating
  • amount:913.59

Stack Uptimes

  • conch_of_dark_whispers_1:23.66%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271071
  • name:Conch of Dark Whispers
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc271072=Your spells have a chance to grant you {$271071s1=649} Critical Strike for {$271071d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Ignition Mage's Fuse 2.9 0.0 120.3sec 120.3sec 19.17% 0.00% 2.8(2.8) 2.8

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:366.08

Stack Uptimes

  • ignition_mages_fuse_1:3.94%
  • ignition_mages_fuse_2:3.89%
  • ignition_mages_fuse_3:3.84%
  • ignition_mages_fuse_4:3.78%
  • ignition_mages_fuse_5:3.73%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lunar Empowerment 33.6 46.2 9.0sec 3.8sec 82.18% 99.71% 1.9(1.9) 0.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:35.73%
  • lunar_empowerment_2:32.06%
  • lunar_empowerment_3:14.39%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Moonkin Form 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Nature's Balance 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 399.0(399.0) 0.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_natures_balance
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.75

Stack Uptimes

  • natures_balance_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202430
  • name:Nature's Balance
  • tooltip:Grants $m3 Astral Power every $m4 sec while in combat or while below 50 Astral Power.
  • description:While in combat you generate $m3 Astral Power every $m4 sec. While out of combat your Astral Power rebalances to 50 instead of depleting to empty.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Overwhelming Power 4.6 3.5 64.3sec 33.5sec 48.23% 0.00% 3.5(49.4) 0.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.38%
  • overwhelming_power_2:1.42%
  • overwhelming_power_3:1.46%
  • overwhelming_power_4:1.50%
  • overwhelming_power_5:1.54%
  • overwhelming_power_6:1.59%
  • overwhelming_power_7:1.63%
  • overwhelming_power_8:1.68%
  • overwhelming_power_9:1.73%
  • overwhelming_power_10:1.77%
  • overwhelming_power_11:1.83%
  • overwhelming_power_12:1.88%
  • overwhelming_power_13:1.93%
  • overwhelming_power_14:1.99%
  • overwhelming_power_15:2.05%
  • overwhelming_power_16:2.11%
  • overwhelming_power_17:2.17%
  • overwhelming_power_18:2.24%
  • overwhelming_power_19:2.31%
  • overwhelming_power_20:2.38%
  • overwhelming_power_21:2.46%
  • overwhelming_power_22:2.53%
  • overwhelming_power_23:2.61%
  • overwhelming_power_24:2.68%
  • overwhelming_power_25:1.37%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Reckless Force 4.0 0.0 67.4sec 67.4sec 5.24% 0.00% 0.0(0.0) 3.9

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_reckless_force
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.70
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • reckless_force_1:5.24%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:302932
  • name:Reckless Force
  • tooltip:Critical Strike increased by {$s1=50}%.
  • description:{$@spelldesc298407=When an ability fails to critically strike, you have a high chance to gain Reckless Force. When Reckless Force reaches {$302917u=20} stacks, your critical strike is increased by {$302932s1=50}% for {$302932d=3 seconds}.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Reckless Force (_counter) 4.9 83.5 67.4sec 3.4sec 91.59% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_reckless_force_counter
  • max_stacks:20
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • reckless_force_counter_1:5.61%
  • reckless_force_counter_2:5.21%
  • reckless_force_counter_3:5.14%
  • reckless_force_counter_4:5.12%
  • reckless_force_counter_5:5.06%
  • reckless_force_counter_6:5.04%
  • reckless_force_counter_7:4.95%
  • reckless_force_counter_8:4.92%
  • reckless_force_counter_9:4.87%
  • reckless_force_counter_10:4.80%
  • reckless_force_counter_11:4.77%
  • reckless_force_counter_12:4.70%
  • reckless_force_counter_13:4.66%
  • reckless_force_counter_14:4.59%
  • reckless_force_counter_15:4.55%
  • reckless_force_counter_16:4.47%
  • reckless_force_counter_17:4.43%
  • reckless_force_counter_18:4.37%
  • reckless_force_counter_19:4.32%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:302917
  • name:Reckless Force
  • tooltip:Upon reaching {$u=20} stacks, you gain $302932s~1% Critical Strike for {$302932d=3 seconds}.
  • description:{$@spelldesc298407=When an ability fails to critically strike, you have a high chance to gain Reckless Force. When Reckless Force reaches {$302917u=20} stacks, your critical strike is increased by {$302932s1=50}% for {$302932d=3 seconds}.}
  • max_stacks:20
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
Solar Empowerment 24.4 52.0 12.1sec 3.9sec 85.60% 79.44% 0.3(0.3) 0.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:27.72%
  • solar_empowerment_2:40.00%
  • solar_empowerment_3:17.88%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starlord 15.2 45.8 20.2sec 4.9sec 97.31% 92.23% 15.8(15.8) 11.2

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:14.39%
  • starlord_2:22.72%
  • starlord_3:60.19%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.3 1.2 61.2sec 45.7sec 23.59% 0.00% 1.2(1.2) 4.0

Buff details

  • buff initial source:unbound force
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.59%

Trigger Attempt Success

  • trigger_pct:99.98%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
unbound force
starsurge Astral Power 61.0 2441.0 40.0 40.0 1693.9
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 93.83 750.59 (31.23%) 8.00 0.06 0.01%
celestial_alignment Astral Power 2.00 80.00 (3.33%) 40.00 0.00 0.00%
sunfire Astral Power 18.06 54.17 (2.25%) 3.00 0.00 0.00%
shooting_stars Astral Power 44.50 177.98 (7.40%) 4.00 0.01 0.00%
moonfire Astral Power 14.03 42.08 (1.75%) 3.00 0.00 0.00%
stellar_flare Astral Power 12.74 101.90 (4.24%) 8.00 0.00 0.00%
lunar_strike Astral Power 76.81 921.71 (38.35%) 12.00 0.07 0.01%
natures_balance Astral Power 400.01 200.00 (8.32%) 0.50 0.00 0.00%
arcanic_pulsar Astral Power 6.26 75.12 (3.13%) 12.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 8.02 8.15
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 19.73 0.00 95.50
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data unbound force Fight Length
Count 15384
Mean 299.63
Minimum 240.01
Maximum 359.99
Spread ( max - min ) 119.97
Range [ ( max - min ) / 2 * 100% ] 20.02%
DPS
Sample Data unbound force Damage Per Second
Count 15384
Mean 41748.56
Minimum 37786.20
Maximum 47417.25
Spread ( max - min ) 9631.05
Range [ ( max - min ) / 2 * 100% ] 11.53%
Standard Deviation 1259.7558
5th Percentile 39754.49
95th Percentile 43907.25
( 95th Percentile - 5th Percentile ) 4152.75
Mean Distribution
Standard Deviation 10.1567
95.00% Confidence Intervall ( 41728.65 - 41768.47 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 35
0.1% Error 3498
0.1 Scale Factor Error with Delta=300 13548
0.05 Scale Factor Error with Delta=300 54190
0.01 Scale Factor Error with Delta=300 1354742
Priority Target DPS
Sample Data unbound force Priority Target Damage Per Second
Count 15384
Mean 41748.56
Minimum 37786.20
Maximum 47417.25
Spread ( max - min ) 9631.05
Range [ ( max - min ) / 2 * 100% ] 11.53%
Standard Deviation 1259.7558
5th Percentile 39754.49
95th Percentile 43907.25
( 95th Percentile - 5th Percentile ) 4152.75
Mean Distribution
Standard Deviation 10.1567
95.00% Confidence Intervall ( 41728.65 - 41768.47 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 35
0.1% Error 3498
0.1 Scale Factor Error with Delta=300 13548
0.05 Scale Factor Error with Delta=300 54190
0.01 Scale Factor Error with Delta=300 1354742
DPS(e)
Sample Data unbound force Damage Per Second (Effective)
Count 15384
Mean 41748.56
Minimum 37786.20
Maximum 47417.25
Spread ( max - min ) 9631.05
Range [ ( max - min ) / 2 * 100% ] 11.53%
Damage
Sample Data unbound force Damage
Count 15384
Mean 12483470.48
Minimum 9674929.35
Maximum 15640046.45
Spread ( max - min ) 5965117.10
Range [ ( max - min ) / 2 * 100% ] 23.89%
DTPS
Sample Data unbound force Damage Taken Per Second
Count 15384
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data unbound force Healing Per Second
Count 15384
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data unbound force Healing Per Second (Effective)
Count 15384
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data unbound force Heal
Count 15384
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data unbound force Healing Taken Per Second
Count 15384
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data unbound force Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data unbound forceTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data unbound force Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
E 1.00 potion,if=buff.ca_inc.remains>6&active_enemies=1
0.00 potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
0.00 blood_fury,if=buff.ca_inc.up
F 2.00 berserking,if=buff.ca_inc.up
0.00 arcane_torrent,if=buff.ca_inc.up
0.00 lights_judgment,if=buff.ca_inc.up
0.00 fireblood,if=buff.ca_inc.up
0.00 ancestral_call,if=buff.ca_inc.up
0.00 use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
0.00 use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
0.00 use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
0.00 use_item,name=tidestorm_codex,if=equipped.165576
G 2.94 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams
0.00 purifying_blast
0.00 ripple_in_space
H 4.92 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
I 2.00 celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
0.00 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
J 3.05 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
0.00 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
K 61.02 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
L 3.02 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
M 2.78 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
N 14.56 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
O 11.25 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
P 12.74 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
Q 77.17 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
R 93.09 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
S 0.48 sunfire

Sample Sequence

0123456789ACDHKONPIFGKRKRQKRQRQKRQRNRORQRQKPRQKQQKRQQQRKNKRQRQRMRJKQKQPQKRNQRKRQQRRKHKORQQKNPRQRRQRRJKRKRQKMNQQKRPQKRQQRKQRKNOQRRKQRRPRRRHKNGQKRQKRQRMKRQQRRRRNPKKQQKORQQRKRQNRRRRKPKQQORKRQKRQHNRRQKQRIEFKPKRORKNRQRKRQRQRKRQLKQQPKRQRKRMQQRRKNQRKQRRKQOPRRRRNGKQKQRRKQHRRRKOPQNRRRKRKRQRKQQQKRQRQ

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask unbound force 58.0/100: 58% astral_power
Pre precombat 1 food unbound force 58.0/100: 58% astral_power
Pre precombat 2 augmentation unbound force 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 9 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power battle_potion_of_intellect
0:00.000 default H the_unbound_force Fluffy_Pillow 66.0/100: 66% astral_power battle_potion_of_intellect
0:01.238 default K starsurge Fluffy_Pillow 66.5/100: 67% astral_power bloodlust, battle_potion_of_intellect
0:02.191 default O moonfire Fluffy_Pillow 27.0/100: 27% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, reckless_force_counter, battle_potion_of_intellect
0:03.116 default N sunfire Fluffy_Pillow 31.0/100: 31% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, reckless_force_counter, battle_potion_of_intellect
0:04.041 default P stellar_flare Fluffy_Pillow 34.5/100: 35% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, reckless_force_counter, battle_potion_of_intellect
0:04.968 default I celestial_alignment Fluffy_Pillow 43.0/100: 43% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(25), reckless_force_counter, battle_potion_of_intellect
0:05.722 default F berserking Fluffy_Pillow 87.5/100: 88% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(24), reckless_force_counter, battle_potion_of_intellect
0:05.722 default G use_items Fluffy_Pillow 87.5/100: 88% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(24), reckless_force_counter, battle_potion_of_intellect
0:05.722 default K starsurge Fluffy_Pillow 87.5/100: 88% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(24), reckless_force_counter, battle_potion_of_intellect, ignition_mages_fuse
0:06.477 default R solar_wrath Fluffy_Pillow 48.0/100: 48% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(23), reckless_force_counter, battle_potion_of_intellect, ignition_mages_fuse
0:07.231 default K starsurge Fluffy_Pillow 56.5/100: 56% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(22), reckless_force_counter, battle_potion_of_intellect, ignition_mages_fuse
0:07.987 default R solar_wrath Fluffy_Pillow 21.0/100: 21% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(22), reckless_force_counter(2), battle_potion_of_intellect, ignition_mages_fuse
0:08.742 default Q lunar_strike Fluffy_Pillow 29.5/100: 30% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(21), reckless_force_counter(2), battle_potion_of_intellect, ignition_mages_fuse
0:09.527 default K starsurge Fluffy_Pillow 42.0/100: 42% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(20), reckless_force_counter(2), battle_potion_of_intellect, ignition_mages_fuse
0:10.281 default R solar_wrath Fluffy_Pillow 2.5/100: 3% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(19), reckless_force_counter(2), battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.035 default Q lunar_strike Fluffy_Pillow 11.0/100: 11% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(18), reckless_force_counter(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.798 default R solar_wrath Fluffy_Pillow 23.5/100: 24% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(18), reckless_force_counter(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.552 default Q lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(17), reckless_force_counter(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.317 default K starsurge Fluffy_Pillow 44.5/100: 45% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(16), reckless_force_counter(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:14.071 default R solar_wrath Fluffy_Pillow 5.0/100: 5% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(15), reckless_force_counter(3), battle_potion_of_intellect, ignition_mages_fuse(3)
0:14.826 default Q lunar_strike Fluffy_Pillow 13.5/100: 14% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(15), reckless_force_counter(3), battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.582 default R solar_wrath Fluffy_Pillow 26.0/100: 26% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(14), reckless_force_counter(3), battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.337 default N sunfire Fluffy_Pillow 34.5/100: 35% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(13), reckless_force_counter(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.091 default R solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(12), reckless_force_counter(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.844 default O moonfire Fluffy_Pillow 46.5/100: 47% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(12), reckless_force_counter(4), battle_potion_of_intellect, ignition_mages_fuse(4)
0:18.596 default R solar_wrath Fluffy_Pillow 50.0/100: 50% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(11), reckless_force_counter(4), battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.351 default Q lunar_strike Fluffy_Pillow 58.5/100: 59% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(10), reckless_force_counter(5), battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.148 default R solar_wrath Fluffy_Pillow 71.0/100: 71% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(9), reckless_force_counter(6), battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.903 default Q lunar_strike Fluffy_Pillow 79.5/100: 80% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(9), reckless_force_counter(7), battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.704 default K starsurge Fluffy_Pillow 92.0/100: 92% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), overwhelming_power(8), reckless_force_counter(7), battle_potion_of_intellect, ignition_mages_fuse(4)
0:22.459 default P stellar_flare Fluffy_Pillow 56.5/100: 56% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord, overwhelming_power(7), reckless_force_counter(7), battle_potion_of_intellect, ignition_mages_fuse(5)
0:23.213 default R solar_wrath Fluffy_Pillow 65.0/100: 65% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord, overwhelming_power(6), reckless_force_counter(7), ignition_mages_fuse(5)
0:23.966 default Q lunar_strike Fluffy_Pillow 73.5/100: 74% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), starlord, overwhelming_power(6), reckless_force_counter(7), ignition_mages_fuse(5)
0:24.793 default K starsurge Fluffy_Pillow 86.5/100: 87% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), starlord, overwhelming_power(5), reckless_force_counter(7), ignition_mages_fuse(5)
0:25.547 default Q lunar_strike Fluffy_Pillow 47.0/100: 47% astral_power bloodlust, arcanic_pulsar(7), lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(4), reckless_force_counter(8), ignition_mages_fuse(5)
0:26.474 default Q lunar_strike Fluffy_Pillow 63.5/100: 64% astral_power bloodlust, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(3), reckless_force_counter(9)
0:27.606 default K starsurge Fluffy_Pillow 76.0/100: 76% astral_power bloodlust, arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(2), reckless_force_counter(9)
0:28.501 default R solar_wrath Fluffy_Pillow 37.0/100: 37% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power, reckless_force_counter(9)
0:29.255 default Q lunar_strike Fluffy_Pillow 45.5/100: 46% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment(2), starlord(3), reckless_force_counter(9)
0:30.370 default Q lunar_strike Fluffy_Pillow 58.0/100: 58% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), reckless_force_counter(9)
0:31.484 default Q lunar_strike Fluffy_Pillow 70.5/100: 71% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), reckless_force_counter(10)
0:32.599 default R solar_wrath Fluffy_Pillow 83.5/100: 84% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment(2), starlord(3), reckless_force_counter(11)
0:33.353 default K starsurge Fluffy_Pillow 92.0/100: 92% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment, starlord(3), reckless_force_counter(12)
0:34.228 default N sunfire Fluffy_Pillow 64.5/100: 65% astral_power bloodlust, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), reckless_force_counter(12)
0:34.990 default K starsurge Fluffy_Pillow 72.0/100: 72% astral_power bloodlust, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), reckless_force_counter(12)
0:35.752 default R solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), reckless_force_counter(12)
0:36.508 default Q lunar_strike Fluffy_Pillow 41.0/100: 41% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), reckless_force_counter(12), conch_of_dark_whispers
0:37.479 default R solar_wrath Fluffy_Pillow 53.5/100: 54% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), reckless_force_counter(12), conch_of_dark_whispers
0:38.234 default Q lunar_strike Fluffy_Pillow 62.0/100: 62% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), reckless_force_counter(12), conch_of_dark_whispers
0:39.204 default R solar_wrath Fluffy_Pillow 75.0/100: 75% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), reckless_force_counter(12), conch_of_dark_whispers
0:39.958 default M moonfire Fluffy_Pillow 83.5/100: 84% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, reckless_force_counter(13), conch_of_dark_whispers
0:40.721 default R solar_wrath Fluffy_Pillow 87.0/100: 87% astral_power bloodlust, arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, reckless_force_counter(13), conch_of_dark_whispers
0:41.475 default J cancel_buff Fluffy_Pillow 95.5/100: 96% astral_power arcanic_pulsar, lunar_empowerment(2), starlord(3), torrent_of_elements, reckless_force_counter(13), conch_of_dark_whispers
0:41.475 default K starsurge Fluffy_Pillow 95.5/100: 96% astral_power arcanic_pulsar, lunar_empowerment(2), torrent_of_elements, reckless_force_counter(13), conch_of_dark_whispers
0:42.715 default Q lunar_strike Fluffy_Pillow 56.0/100: 56% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord, torrent_of_elements, reckless_force_counter(13), conch_of_dark_whispers
0:44.246 default K starsurge Fluffy_Pillow 69.0/100: 69% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements, reckless_force_counter(13), conch_of_dark_whispers
0:45.446 default Q lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(2), torrent_of_elements, reckless_force_counter(14), conch_of_dark_whispers
0:46.936 default P stellar_flare Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, reckless_force_counter(14), conch_of_dark_whispers
0:48.104 default Q lunar_strike Fluffy_Pillow 56.0/100: 56% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, reckless_force_counter(15), conch_of_dark_whispers
0:49.593 default K starsurge Fluffy_Pillow 69.0/100: 69% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, reckless_force_counter(15), conch_of_dark_whispers
0:50.761 default R solar_wrath Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, reckless_force_counter(15), conch_of_dark_whispers
0:51.728 default N sunfire Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, reckless_force_counter(15), conch_of_dark_whispers
0:52.866 default Q lunar_strike Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, reckless_force_counter(15), conch_of_dark_whispers
0:54.313 default R solar_wrath Fluffy_Pillow 55.0/100: 55% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, reckless_force_counter(15), conch_of_dark_whispers
0:55.278 default K starsurge Fluffy_Pillow 63.5/100: 64% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), reckless_force_counter(15), conch_of_dark_whispers
0:56.415 default R solar_wrath Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), reckless_force_counter(15)
0:57.382 default Q lunar_strike Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), reckless_force_counter(16)
0:58.831 default Q lunar_strike Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), reckless_force_counter(17)
1:00.278 default R solar_wrath Fluffy_Pillow 59.0/100: 59% astral_power arcanic_pulsar(5), solar_empowerment(3), starlord(3), reckless_force_counter(17)
1:01.243 default R solar_wrath Fluffy_Pillow 67.5/100: 68% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), reckless_force_counter(17)
1:02.208 default K starsurge Fluffy_Pillow 80.0/100: 80% astral_power arcanic_pulsar(5), solar_empowerment, reckless_force_counter(19)
1:03.448 default H the_unbound_force Fluffy_Pillow 41.0/100: 41% astral_power reckless_force, arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord
1:04.653 default K starsurge Fluffy_Pillow 42.0/100: 42% astral_power reckless_force, arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord, reckless_force_counter
1:05.855 default O moonfire Fluffy_Pillow 2.5/100: 3% astral_power reckless_force, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(2), reckless_force_counter
1:07.022 default R solar_wrath Fluffy_Pillow 10.5/100: 11% astral_power reckless_force, arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(2), reckless_force_counter
1:08.016 default Q lunar_strike Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), reckless_force_counter
1:09.505 default Q lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), reckless_force_counter
1:10.993 default K starsurge Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(2), reckless_force_counter
1:12.162 default N sunfire Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), reckless_force_counter
1:13.300 default P stellar_flare Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), reckless_force_counter
1:14.437 default R solar_wrath Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), reckless_force_counter(2)
1:15.402 default Q lunar_strike Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(25), reckless_force_counter(2)
1:16.726 default R solar_wrath Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), overwhelming_power(24), reckless_force_counter(2)
1:17.614 default R solar_wrath Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(23), reckless_force_counter(2)
1:18.503 default Q lunar_strike Fluffy_Pillow 65.0/100: 65% astral_power arcanic_pulsar(8), lunar_empowerment, starlord(3), overwhelming_power(22), reckless_force_counter(2)
1:19.842 default R solar_wrath Fluffy_Pillow 78.0/100: 78% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(21), reckless_force_counter(2)
1:20.895 default R solar_wrath Fluffy_Pillow 86.5/100: 87% astral_power arcanic_pulsar(8), lunar_empowerment, starlord(3), overwhelming_power(20), reckless_force_counter(3)
1:21.953 default J cancel_buff Fluffy_Pillow 95.5/100: 96% astral_power arcanic_pulsar(8), lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(19), reckless_force_counter(4)
1:21.953 default K starsurge Fluffy_Pillow 95.5/100: 96% astral_power arcanic_pulsar(8), lunar_empowerment, torrent_of_elements, overwhelming_power(19), reckless_force_counter(4)
1:23.112 default R solar_wrath Fluffy_Pillow 72.0/100: 72% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(17), reckless_force_counter(4)
1:23.948 default K starsurge Fluffy_Pillow 80.5/100: 81% astral_power celestial_alignment, lunar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(17), reckless_force_counter(4)
1:24.933 default R solar_wrath Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(16), reckless_force_counter(4)
1:25.746 default Q lunar_strike Fluffy_Pillow 58.0/100: 58% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(2), torrent_of_elements, overwhelming_power(25), reckless_force_counter(4)
1:26.929 default K starsurge Fluffy_Pillow 70.5/100: 71% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(25), reckless_force_counter(4)
1:27.858 default M moonfire Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(24), reckless_force_counter(4)
1:28.766 default N sunfire Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(23), reckless_force_counter(4)
1:29.812 default Q lunar_strike Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(22), reckless_force_counter(5)
1:31.150 default Q lunar_strike Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(20), reckless_force_counter(5)
1:32.498 default K starsurge Fluffy_Pillow 68.5/100: 69% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(19), reckless_force_counter(6)
1:33.559 default R solar_wrath Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(18), reckless_force_counter(7)
1:34.466 default P stellar_flare Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(17), reckless_force_counter(8)
1:35.535 default Q lunar_strike Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(16), reckless_force_counter(9)
1:36.902 default K starsurge Fluffy_Pillow 59.5/100: 60% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(15), reckless_force_counter(9)
1:37.978 default R solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(14), reckless_force_counter(9)
1:38.895 default Q lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(13), reckless_force_counter(10)
1:40.277 default Q lunar_strike Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(11), reckless_force_counter(11)
1:41.668 default R solar_wrath Fluffy_Pillow 54.5/100: 55% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), overwhelming_power(10), reckless_force_counter(11)
1:42.599 default K starsurge Fluffy_Pillow 63.0/100: 63% astral_power arcanic_pulsar(4), solar_empowerment, overwhelming_power(9), reckless_force_counter(11)
1:43.799 default Q lunar_strike Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(8), reckless_force_counter(11)
1:45.286 default R solar_wrath Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord, overwhelming_power(6), reckless_force_counter(13)
1:46.286 default K starsurge Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(5), solar_empowerment, starlord, overwhelming_power(5), reckless_force_counter(13), conch_of_dark_whispers
1:47.467 default N sunfire Fluffy_Pillow 6.5/100: 7% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(4), reckless_force_counter(13), conch_of_dark_whispers
1:48.618 default O moonfire Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(3), reckless_force_counter(14), conch_of_dark_whispers
1:49.772 default Q lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(2), reckless_force_counter(15), conch_of_dark_whispers
1:51.250 default R solar_wrath Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(2), reckless_force_counter(15), conch_of_dark_whispers
1:52.246 default R solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(6), solar_empowerment, starlord(2), reckless_force_counter(16), conch_of_dark_whispers
1:53.239 default K starsurge Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(6), starlord(2), reckless_force_counter(16), conch_of_dark_whispers
1:54.407 default Q lunar_strike Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(3), reckless_force_counter(17), conch_of_dark_whispers
1:55.855 default R solar_wrath Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), reckless_force_counter(19), conch_of_dark_whispers
1:56.822 default R solar_wrath Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), reckless_force_counter(19), conch_of_dark_whispers
1:57.789 default P stellar_flare Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(7), starlord(3), reckless_force_counter(19), conch_of_dark_whispers
1:58.925 default R solar_wrath Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(7), starlord(3), reckless_force_counter(19), conch_of_dark_whispers
2:00.062 default R solar_wrath Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar(7), starlord(3), reckless_force_counter(19), conch_of_dark_whispers
2:01.199 default R solar_wrath Fluffy_Pillow 61.5/100: 62% astral_power arcanic_pulsar(7), starlord(3), reckless_force_counter(19), conch_of_dark_whispers
2:02.336 default H the_unbound_force Fluffy_Pillow 70.5/100: 71% astral_power reckless_force, arcanic_pulsar(7), starlord(3)
2:03.472 default K starsurge Fluffy_Pillow 71.0/100: 71% astral_power reckless_force, arcanic_pulsar(7)
2:04.711 default N sunfire Fluffy_Pillow 32.0/100: 32% astral_power reckless_force, arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord
2:05.914 default G use_items Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(24)
2:05.914 default Q lunar_strike Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(24), ignition_mages_fuse
2:07.266 default K starsurge Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(8), solar_empowerment, starlord, overwhelming_power(22), reckless_force_counter, ignition_mages_fuse
2:08.335 default R solar_wrath Fluffy_Pillow 25.5/100: 26% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(21), reckless_force_counter(2), ignition_mages_fuse
2:09.105 default Q lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(20), reckless_force_counter(2), ignition_mages_fuse
2:10.262 default K starsurge Fluffy_Pillow 46.5/100: 47% astral_power celestial_alignment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(19), reckless_force_counter(2), ignition_mages_fuse(2)
2:11.141 default R solar_wrath Fluffy_Pillow 7.0/100: 7% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(18), reckless_force_counter(2), ignition_mages_fuse(2)
2:11.898 default Q lunar_strike Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(18), reckless_force_counter(3), ignition_mages_fuse(2)
2:12.987 default R solar_wrath Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar, celestial_alignment, solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(17), reckless_force_counter(4), ignition_mages_fuse(2)
2:13.742 default M moonfire Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(16), reckless_force_counter(4), ignition_mages_fuse(2)
2:14.602 default K starsurge Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(15), reckless_force_counter(4), ignition_mages_fuse(3)
2:15.559 default R solar_wrath Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(14), reckless_force_counter(4), ignition_mages_fuse(3)
2:16.373 default Q lunar_strike Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(13), reckless_force_counter(5), ignition_mages_fuse(3)
2:17.600 default Q lunar_strike Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(12), reckless_force_counter(5), ignition_mages_fuse(3)
2:18.831 default R solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(11), reckless_force_counter(6), ignition_mages_fuse(4)
2:19.624 default R solar_wrath Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(10), reckless_force_counter(6), ignition_mages_fuse(4)
2:20.421 default R solar_wrath Fluffy_Pillow 56.5/100: 56% astral_power arcanic_pulsar(2), starlord(3), torrent_of_elements, overwhelming_power(9), reckless_force_counter(6), ignition_mages_fuse(4)
2:21.359 default R solar_wrath Fluffy_Pillow 69.0/100: 69% astral_power arcanic_pulsar(2), starlord(3), torrent_of_elements, overwhelming_power(8), reckless_force_counter(6), ignition_mages_fuse(4)
2:22.303 default N sunfire Fluffy_Pillow 77.5/100: 78% astral_power arcanic_pulsar(2), lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(7), reckless_force_counter(7), ignition_mages_fuse(5)
2:23.215 default P stellar_flare Fluffy_Pillow 81.0/100: 81% astral_power arcanic_pulsar(2), lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(6), reckless_force_counter(7), ignition_mages_fuse(5)
2:24.130 default K starsurge Fluffy_Pillow 90.0/100: 90% astral_power arcanic_pulsar(2), lunar_empowerment, overwhelming_power(5), reckless_force_counter(8), ignition_mages_fuse(5)
2:25.129 default K starsurge Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(4), reckless_force_counter(8), ignition_mages_fuse(5)
2:26.101 default Q lunar_strike Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar(4), lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(3), reckless_force_counter(8)
2:27.574 default Q lunar_strike Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(2), reckless_force_counter(8)
2:29.052 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), reckless_force_counter(9)
2:30.221 default O moonfire Fluffy_Pillow 2.0/100: 2% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), reckless_force_counter(9)
2:31.358 default R solar_wrath Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(3), starlord(3), reckless_force_counter(9)
2:32.327 default Q lunar_strike Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), reckless_force_counter(9)
2:33.774 default Q lunar_strike Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), reckless_force_counter(10)
2:35.221 default R solar_wrath Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(5), solar_empowerment(3), starlord(3), reckless_force_counter(10)
2:36.188 default K starsurge Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), reckless_force_counter(10)
2:37.322 default R solar_wrath Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(3), reckless_force_counter(10)
2:38.288 default Q lunar_strike Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), reckless_force_counter(11)
2:39.735 default N sunfire Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), reckless_force_counter(12)
2:40.871 default R solar_wrath Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), reckless_force_counter(12)
2:41.839 default R solar_wrath Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), reckless_force_counter(12)
2:42.805 default R solar_wrath Fluffy_Pillow 60.5/100: 61% astral_power arcanic_pulsar(6), starlord(3), reckless_force_counter(12)
2:43.943 default R solar_wrath Fluffy_Pillow 69.0/100: 69% astral_power arcanic_pulsar(6), starlord(3), reckless_force_counter(12)
2:45.080 default K starsurge Fluffy_Pillow 78.0/100: 78% astral_power arcanic_pulsar(6), reckless_force_counter(13)
2:46.318 default P stellar_flare Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord, reckless_force_counter(14)
2:47.522 default K starsurge Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord, reckless_force_counter(15)
2:48.725 default Q lunar_strike Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, reckless_force_counter(15)
2:50.213 default Q lunar_strike Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, reckless_force_counter(18)
2:51.701 default O moonfire Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(2), torrent_of_elements, reckless_force_counter(18)
2:52.869 default R solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(2), torrent_of_elements, reckless_force_counter(18)
2:53.863 default K starsurge Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(8), solar_empowerment, starlord(2), torrent_of_elements, reckless_force_counter(19)
2:55.032 default R solar_wrath Fluffy_Pillow 19.5/100: 20% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, reckless_force_counter(19)
2:55.871 default Q lunar_strike Fluffy_Pillow 28.0/100: 28% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, reckless_force_counter(19)
2:57.130 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power celestial_alignment, solar_empowerment, starlord(3), torrent_of_elements, reckless_force_counter(19)
2:58.118 default R solar_wrath Fluffy_Pillow 1.5/100: 2% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, reckless_force_counter(19)
2:58.958 default Q lunar_strike Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, reckless_force_counter(19)
3:00.218 default H the_unbound_force Fluffy_Pillow 23.0/100: 23% astral_power reckless_force, arcanic_pulsar, celestial_alignment, solar_empowerment, starlord(3), torrent_of_elements
3:01.207 default N sunfire Fluffy_Pillow 23.5/100: 24% astral_power reckless_force, arcanic_pulsar, solar_empowerment, starlord(3), torrent_of_elements
3:02.342 default R solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power reckless_force, arcanic_pulsar, solar_empowerment, starlord(3), torrent_of_elements
3:03.308 default R solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power reckless_force, arcanic_pulsar, starlord(3), torrent_of_elements
3:04.446 default Q lunar_strike Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar, lunar_empowerment, starlord(3), torrent_of_elements, reckless_force_counter
3:05.892 default K starsurge Fluffy_Pillow 61.5/100: 62% astral_power arcanic_pulsar, reckless_force_counter(2)
3:07.130 default Q lunar_strike Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord, reckless_force_counter(2)
3:08.660 default R solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord, reckless_force_counter(3)
3:09.685 default I celestial_alignment Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(2), celestial_alignment, solar_empowerment, starlord, reckless_force_counter(3)
3:10.731 default E potion Fluffy_Pillow 85.0/100: 85% astral_power arcanic_pulsar(2), celestial_alignment, solar_empowerment, starlord, reckless_force_counter(4)
3:10.731 default F berserking Fluffy_Pillow 85.0/100: 85% astral_power arcanic_pulsar(2), celestial_alignment, solar_empowerment, starlord, reckless_force_counter(4), battle_potion_of_intellect
3:10.731 default K starsurge Fluffy_Pillow 85.0/100: 85% astral_power berserking, arcanic_pulsar(2), celestial_alignment, solar_empowerment, starlord, reckless_force_counter(4), battle_potion_of_intellect
3:11.683 default P stellar_flare Fluffy_Pillow 49.5/100: 50% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), reckless_force_counter(4), battle_potion_of_intellect
3:12.608 default K starsurge Fluffy_Pillow 58.0/100: 58% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), reckless_force_counter(5), battle_potion_of_intellect
3:13.531 default R solar_wrath Fluffy_Pillow 19.0/100: 19% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), reckless_force_counter(5), battle_potion_of_intellect
3:14.296 default O moonfire Fluffy_Pillow 27.5/100: 28% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), reckless_force_counter(5), battle_potion_of_intellect
3:15.196 default R solar_wrath Fluffy_Pillow 35.0/100: 35% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), reckless_force_counter(5), battle_potion_of_intellect
3:15.963 default K starsurge Fluffy_Pillow 43.5/100: 44% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), reckless_force_counter(5), battle_potion_of_intellect
3:16.862 default N sunfire Fluffy_Pillow 4.0/100: 4% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), reckless_force_counter(5), battle_potion_of_intellect
3:17.761 default R solar_wrath Fluffy_Pillow 7.5/100: 8% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), reckless_force_counter(6), battle_potion_of_intellect
3:18.526 default Q lunar_strike Fluffy_Pillow 16.0/100: 16% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), reckless_force_counter(6), battle_potion_of_intellect
3:19.671 default R solar_wrath Fluffy_Pillow 33.0/100: 33% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), reckless_force_counter(6), battle_potion_of_intellect
3:20.435 default K starsurge Fluffy_Pillow 41.5/100: 42% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), reckless_force_counter(6), battle_potion_of_intellect
3:21.336 default R solar_wrath Fluffy_Pillow 2.0/100: 2% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), reckless_force_counter(6), battle_potion_of_intellect
3:22.102 default Q lunar_strike Fluffy_Pillow 10.5/100: 11% astral_power berserking, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), starlord(3), reckless_force_counter(6), battle_potion_of_intellect
3:23.246 default R solar_wrath Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(25), reckless_force_counter(7), battle_potion_of_intellect
3:24.150 default Q lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(24), reckless_force_counter(7), battle_potion_of_intellect
3:25.305 default R solar_wrath Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(23), reckless_force_counter(7), battle_potion_of_intellect
3:26.215 default K starsurge Fluffy_Pillow 57.0/100: 57% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), overwhelming_power(22), reckless_force_counter(7), battle_potion_of_intellect
3:27.211 default R solar_wrath Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord, overwhelming_power(21), reckless_force_counter(7), battle_potion_of_intellect
3:28.036 default Q lunar_strike Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), starlord, overwhelming_power(20), reckless_force_counter(7), battle_potion_of_intellect
3:29.276 default L sunfire Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(19), reckless_force_counter(8), battle_potion_of_intellect
3:30.252 default K starsurge Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(18), reckless_force_counter(8), battle_potion_of_intellect
3:31.379 default Q lunar_strike Fluffy_Pillow 7.5/100: 8% astral_power arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(17), reckless_force_counter(9), battle_potion_of_intellect
3:32.778 default Q lunar_strike Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(16), reckless_force_counter(10), battle_potion_of_intellect
3:34.181 default P stellar_flare Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(14), reckless_force_counter(10), battle_potion_of_intellect
3:35.291 default K starsurge Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(13), reckless_force_counter(11), battle_potion_of_intellect
3:36.405 default R solar_wrath Fluffy_Pillow 15.0/100: 15% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(12), reckless_force_counter(11)
3:37.208 default Q lunar_strike Fluffy_Pillow 23.5/100: 24% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(11), reckless_force_counter(11)
3:38.418 default R solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(10), reckless_force_counter(11)
3:39.228 default K starsurge Fluffy_Pillow 45.0/100: 45% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(9), reckless_force_counter(11)
3:40.184 default R solar_wrath Fluffy_Pillow 5.5/100: 6% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(8), reckless_force_counter(11)
3:41.000 default M moonfire Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(7), reckless_force_counter(11)
3:41.963 default Q lunar_strike Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(7), reckless_force_counter(12)
3:43.373 default Q lunar_strike Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(5), reckless_force_counter(12)
3:44.794 default R solar_wrath Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar, solar_empowerment(3), starlord(3), overwhelming_power(4), reckless_force_counter(12)
3:45.744 default R solar_wrath Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar, solar_empowerment(2), starlord(3), overwhelming_power(3), reckless_force_counter(13)
3:46.699 default K starsurge Fluffy_Pillow 61.0/100: 61% astral_power arcanic_pulsar, solar_empowerment, overwhelming_power(2), reckless_force_counter(13)
3:47.928 default N sunfire Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power, reckless_force_counter(13)
3:49.126 default Q lunar_strike Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord, reckless_force_counter(13)
3:50.658 default R solar_wrath Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord, reckless_force_counter(14)
3:51.682 default K starsurge Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(2), solar_empowerment, starlord, reckless_force_counter(14)
3:52.883 default Q lunar_strike Fluffy_Pillow 8.0/100: 8% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), reckless_force_counter(15)
3:54.371 default R solar_wrath Fluffy_Pillow 21.0/100: 21% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(2), reckless_force_counter(15)
3:55.364 default R solar_wrath Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(3), solar_empowerment, starlord(2), reckless_force_counter(16)
3:56.357 default K starsurge Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(3), starlord(2), reckless_force_counter(16)
3:57.525 default Q lunar_strike Fluffy_Pillow 3.0/100: 3% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord(3), reckless_force_counter(16)
3:58.973 default O moonfire Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar(4), solar_empowerment, starlord(3), reckless_force_counter(17)
4:00.109 default P stellar_flare Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar(4), solar_empowerment, starlord(3), reckless_force_counter(17)
4:01.245 default R solar_wrath Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(4), solar_empowerment, starlord(3), reckless_force_counter(17)
4:02.210 default R solar_wrath Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(4), starlord(3), reckless_force_counter(17)
4:03.347 default R solar_wrath Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(4), starlord(3), reckless_force_counter(18), conch_of_dark_whispers
4:04.485 default R solar_wrath Fluffy_Pillow 58.5/100: 59% astral_power arcanic_pulsar(4), starlord(3), reckless_force_counter(18), conch_of_dark_whispers
4:05.619 default N sunfire Fluffy_Pillow 67.5/100: 68% astral_power arcanic_pulsar(4), starlord(3), reckless_force_counter(19), conch_of_dark_whispers
4:06.756 default G use_items Fluffy_Pillow 71.5/100: 72% astral_power arcanic_pulsar(4), reckless_force_counter(19), conch_of_dark_whispers
4:06.756 default K starsurge Fluffy_Pillow 71.5/100: 72% astral_power arcanic_pulsar(4), reckless_force_counter(19), conch_of_dark_whispers, ignition_mages_fuse
4:07.942 default Q lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord, reckless_force_counter(19), conch_of_dark_whispers, ignition_mages_fuse
4:09.410 default K starsurge Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar(5), solar_empowerment, starlord, reckless_force_counter(19), conch_of_dark_whispers, ignition_mages_fuse
4:10.560 default Q lunar_strike Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), reckless_force_counter(19), conch_of_dark_whispers, ignition_mages_fuse
4:11.984 default R solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(2), reckless_force_counter(19), conch_of_dark_whispers, ignition_mages_fuse(2)
4:12.896 default R solar_wrath Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(6), solar_empowerment, starlord(2), torrent_of_elements, reckless_force_counter(19), conch_of_dark_whispers, ignition_mages_fuse(2)
4:13.810 default K starsurge Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(6), starlord(2), torrent_of_elements, reckless_force_counter(19), conch_of_dark_whispers, ignition_mages_fuse(2)
4:14.883 default Q lunar_strike Fluffy_Pillow 0.5/100: 1% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, reckless_force_counter(19), conch_of_dark_whispers, ignition_mages_fuse(3)
4:16.160 default H the_unbound_force Fluffy_Pillow 17.5/100: 18% astral_power reckless_force, arcanic_pulsar(7), solar_empowerment, starlord(3), torrent_of_elements, conch_of_dark_whispers, ignition_mages_fuse(3)
4:17.164 default R solar_wrath Fluffy_Pillow 18.0/100: 18% astral_power reckless_force, arcanic_pulsar(7), solar_empowerment, starlord(3), torrent_of_elements, conch_of_dark_whispers, ignition_mages_fuse(3)
4:18.018 default R solar_wrath Fluffy_Pillow 27.0/100: 27% astral_power reckless_force, arcanic_pulsar(7), starlord(3), torrent_of_elements, ignition_mages_fuse(3)
4:19.022 default R solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power reckless_force, arcanic_pulsar(7), starlord(3), torrent_of_elements, conch_of_dark_whispers, ignition_mages_fuse(4)
4:19.989 default K starsurge Fluffy_Pillow 44.0/100: 44% astral_power reckless_force, arcanic_pulsar(7), starlord(3), torrent_of_elements, conch_of_dark_whispers, ignition_mages_fuse(4)
4:20.955 default O moonfire Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, conch_of_dark_whispers, ignition_mages_fuse(4)
4:21.922 default P stellar_flare Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, conch_of_dark_whispers, ignition_mages_fuse(4)
4:22.889 default Q lunar_strike Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(25), reckless_force_counter, conch_of_dark_whispers, ignition_mages_fuse(5)
4:23.992 default N sunfire Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(24), reckless_force_counter(2), conch_of_dark_whispers, ignition_mages_fuse(5)
4:24.861 default R solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(23), reckless_force_counter(2), conch_of_dark_whispers, ignition_mages_fuse(5)
4:25.617 default R solar_wrath Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(22), reckless_force_counter(4), conch_of_dark_whispers, ignition_mages_fuse(5)
4:26.371 default R solar_wrath Fluffy_Pillow 54.5/100: 55% astral_power arcanic_pulsar(8), starlord(3), torrent_of_elements, overwhelming_power(21), reckless_force_counter(4), conch_of_dark_whispers, ignition_mages_fuse(5)
4:27.245 default K starsurge Fluffy_Pillow 63.0/100: 63% astral_power arcanic_pulsar(8), lunar_empowerment, overwhelming_power(20), reckless_force_counter(4), conch_of_dark_whispers
4:28.396 default R solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(19), reckless_force_counter(4), conch_of_dark_whispers
4:29.227 default K starsurge Fluffy_Pillow 44.0/100: 44% astral_power celestial_alignment, lunar_empowerment(2), starlord, overwhelming_power(18), reckless_force_counter(4), conch_of_dark_whispers
4:30.208 default R solar_wrath Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(17), reckless_force_counter(4), conch_of_dark_whispers
4:31.021 default Q lunar_strike Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(2), overwhelming_power(16), reckless_force_counter(4), conch_of_dark_whispers
4:32.243 default R solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), overwhelming_power(15), reckless_force_counter(4), conch_of_dark_whispers
4:33.206 default K starsurge Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), overwhelming_power(14), reckless_force_counter(4), conch_of_dark_whispers
4:34.173 default Q lunar_strike Fluffy_Pillow 3.5/100: 4% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(13), reckless_force_counter(4), conch_of_dark_whispers
4:35.552 default Q lunar_strike Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(25), reckless_force_counter(4), conch_of_dark_whispers
4:36.874 default Q lunar_strike Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(24), reckless_force_counter(5), conch_of_dark_whispers
4:38.203 default K starsurge Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(2), solar_empowerment(2), starlord(3), overwhelming_power(22), reckless_force_counter(5), conch_of_dark_whispers
4:39.254 default R solar_wrath Fluffy_Pillow 3.0/100: 3% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(21), reckless_force_counter(5)
4:40.151 default Q lunar_strike Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(20), reckless_force_counter(6)
4:41.498 default R solar_wrath Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(19), reckless_force_counter(6)
4:42.401 default Q lunar_strike Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(18), reckless_force_counter(6)

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 16238 14762 13761
Intellect 1467 -3 13346 11714 9693 (6045)
Spirit 0 0 0 0 0
Health 324760 295240 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 13346 11714 0
Crit 15.68% 15.68% 769
Haste 21.51% 21.51% 1463
Damage / Heal Versatility 4.81% 4.81% 409
ManaReg per Second 2378 640 0
Attack Power 13880 12183 0
Mastery 55.20% 55.20% 2005
Armor 2962 2962 2962
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 447.00
Local Head Hood of the Slithering Loa
ilevel: 450, stats: { 407 Armor, +1145 AgiInt, +2255 Sta }
Local Neck Heart of Azeroth
ilevel: 463, stats: { +325 Haste, +325 Crit, +325 Mastery, +719 Sta, +382 StrAgiInt }
Local Shoulders Gorak Tul's Mantle
ilevel: 450, stats: { 376 Armor, +859 AgiInt, +1691 Sta }
Local Chest Spymaster's Wrap
ilevel: 450, stats: { 501 Armor, +1145 AgiInt, +2255 Sta }
Local Waist Beloved Monarch's Waistwrap
ilevel: 445, stats: { 271 Armor, +431 AgiInt, +789 Sta, +147 Mastery, +82 Crit }
Local Legs Leggings of the Stormborn
ilevel: 445, stats: { 422 Armor, +575 AgiInt, +1053 Sta, +179 Vers, +126 Crit }
Local Feet Ancient Tempest Striders
ilevel: 445, stats: { 331 Armor, +431 AgiInt, +789 Sta, +134 Mastery, +95 Haste }
Local Wrists Tideblood Bracers
ilevel: 445, stats: { 211 Armor, +323 AgiInt, +592 Sta, +105 Haste, +66 Crit }
Local Hands Gloves of Incomparable Beauty
ilevel: 445, stats: { 301 Armor, +431 AgiInt, +789 Sta, +134 Haste, +95 Mastery }
Local Finger1 Boralus Noble's Seal
ilevel: 445, stats: { +592 Sta, +369 Mastery, +169 Haste }, enchant: { +60 Haste }
Local Finger2 Cursed Lover's Ring
ilevel: 445, stats: { +592 Sta, +307 Haste, +230 Vers }, enchant: { +60 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 445, stats: { +546 Int }
Local Trinket2 Conch of Dark Whispers
ilevel: 445, stats: { +546 Int }
Local Back Cloak of Ill Tidings
ilevel: 445, stats: { 142 Armor, +323 StrAgiInt, +592 Sta, +110 Mastery, +61 Crit }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 445, weapon: { 661 - 896, 3.6 }, stats: { +575 Int, +1053 Sta, +109 Haste, +109 Crit, +109 Mastery, +1981 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="unbound force"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
talents=1000231
azerite_override=lifespeed:450/heed_my_call:450/overwhelming_power:450/streaking_stars:450/streaking_stars:450/streaking_stars:450/arcanic_pulsar:450/loyal_to_the_end:450/loyal_to_the_end:450

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6&active_enemies=1
actions+=/potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
actions+=/blood_fury,if=buff.ca_inc.up
actions+=/berserking,if=buff.ca_inc.up
actions+=/arcane_torrent,if=buff.ca_inc.up
actions+=/lights_judgment,if=buff.ca_inc.up
actions+=/fireblood,if=buff.ca_inc.up
actions+=/ancestral_call,if=buff.ca_inc.up
actions+=/use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
actions+=/use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
actions+=/use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
actions+=/celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=hood_of_the_slithering_loa,id=159318,ilevel=450
neck=heart_of_azeroth,id=158075,ilevel=463
shoulders=gorak_tuls_mantle,id=159339,ilevel=450
back=cloak_of_ill_tidings,id=168391,ilevel=445
chest=spymasters_wrap,id=155860,ilevel=450
wrists=tideblood_bracers,id=168377,ilevel=445
hands=gloves_of_incomparable_beauty,id=168887,ilevel=445
waist=beloved_monarchs_waistwrap,id=168871,ilevel=445
legs=leggings_of_the_stormborn,id=168378,ilevel=445
feet=ancient_tempest_striders,id=168380,ilevel=445
finger1=boralus_nobles_seal,id=168889,ilevel=445,enchant=60haste
finger2=cursed_lovers_ring,id=168891,ilevel=445,enchant=60haste
trinket1=ignition_mages_fuse,id=159615,ilevel=445
trinket2=conch_of_dark_whispers,id=159620,ilevel=445
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=445,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=447.20
# gear_stamina=13761
# gear_intellect=9693
# gear_crit_rating=769
# gear_haste_rating=1364
# gear_mastery_rating=1289
# gear_versatility_rating=409
# gear_armor=2962

visions : 45490 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
45489.8 45489.8 31.8 / 0.070% 7897.5 / 17.4% 5106.1
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.9 8.8 Astral Power 0.00% 59.8 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Stellar Flare (Balance Druid)
  • 100: Shooting Stars (Balance Druid)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
visions 45490
Heed My Call 306 (438) 0.7% (1.0%) 8.4 32.71sec 15656 0 Direct 8.4 9221 18441 10962 18.9%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.38 8.38 0.00 0.00 0.0000 0.0000 91851.80 91851.80 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.80 81.12% 9220.65 9012 9913 9220.13 0 9913 62675 62675 0.00
crit 1.58 18.88% 18441.32 18024 19826 14723.79 0 19826 29177 29177 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 131 0.3% 8.4 32.71sec 4695 0 Direct 8.4 3952 7902 4695 18.8%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.38 8.38 0.00 0.00 0.0000 0.0000 39337.07 39337.07 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.80 81.20% 3951.86 3862 4248 3951.20 0 4248 26889 26889 0.00
crit 1.58 18.80% 7902.14 7725 8497 6355.97 0 8497 12449 12449 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 6195 13.6% 79.7 3.68sec 23272 18245 Direct 79.7 19611 39208 23272 18.7%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 79.74 79.74 0.00 0.00 1.2755 0.0000 1855584.93 1855584.93 0.00 18244.60 18244.60
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 64.84 81.32% 19611.12 10238 24458 19612.14 18734 20586 1271619 1271619 0.00
crit 14.89 18.68% 39208.23 20477 48917 39206.95 33691 44190 583966 583966 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 3005 6.6% 14.3 21.20sec 63133 63041 Direct 14.3 3338 6679 3964 18.7%  
Periodic 228.1 3116 6228 3698 18.7% 99.3%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.25 14.25 228.10 228.10 1.0015 1.3040 899912.71 899912.71 0.00 2886.93 63041.17
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.59 81.28% 3338.35 3012 4107 3338.17 3088 3669 38678 38678 0.00
crit 2.67 18.72% 6678.57 6024 8213 6324.03 0 8213 17821 17821 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 185.5 81.31% 3116.11 3 3823 3116.21 3010 3268 577967 577967 0.00
crit 42.6 18.69% 6227.74 5 7647 6227.66 5837 6788 265447 265447 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Shooting Stars 967 2.1% 45.5 6.41sec 6362 0 Direct 45.5 5358 10704 6362 18.8%  

Stats details: shooting_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.54 45.54 0.00 0.00 0.0000 0.0000 289693.01 289693.01 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.98 81.22% 5357.79 4818 6569 5357.71 4960 5788 198151 198151 0.00
crit 8.55 18.78% 10704.25 9636 13139 10698.50 0 13139 91542 91542 0.00
 
 

Action details: shooting_stars

Static Values
  • id:202497
  • school:astral
  • resource:none
  • range:50000.0
  • travel_speed:0.8000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating ${$202497m2/10} Astral Power.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.360000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Solar Wrath 3367 (5498) 7.4% (12.1%) 93.9 3.14sec 17546 20052 Direct 94.4 8997 17992 10678 18.7%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 93.87 94.43 0.00 0.00 0.8750 0.0000 1008334.82 1008334.82 0.00 20052.11 20052.11
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 76.79 81.32% 8997.44 8030 10949 8998.80 8601 9497 690947 690947 0.00
crit 17.64 18.68% 17991.73 16060 21898 17993.42 16060 20046 317388 317388 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (solar_empowerment) 2131 4.7% 79.5 3.69sec 8029 0 Direct 79.5 8029 0 8029 0.0%  

Stats details: solar_empowerment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 79.55 79.55 0.00 0.00 0.0000 0.0000 638685.46 638685.46 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 79.55 100.00% 8029.20 6023 16423 8029.53 6837 9519 638685 638685 0.00
 
 

Action details: solar_empowerment

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:7618.57
  • base_dd_max:7618.57
  • base_dd_mult:1.00
 
Starsurge 15241 33.5% 66.7 4.53sec 68412 66986 Direct 66.5 57860 115672 68680 18.7%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 66.74 66.48 0.00 0.00 1.0213 0.0000 4565613.85 4565613.85 0.00 66985.74 66985.74
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 54.04 81.28% 57860.14 51872 70323 57854.61 55143 61023 3126496 3126496 0.00
crit 12.44 18.72% 115672.14 103744 140646 115661.19 103744 131263 1439118 1439118 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Stellar Flare 1951 4.3% 12.8 23.57sec 45690 44890 Direct 12.8 2855 5708 3390 18.7%  
Periodic 225.7 2020 4037 2397 18.7% 98.4%

Stats details: stellar_flare

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.79 12.79 225.66 225.66 1.0179 1.3069 584292.98 584292.98 0.00 1897.50 44890.36
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.39 81.28% 2855.44 2596 3540 2855.50 2596 3184 29680 29680 0.00
crit 2.39 18.72% 5708.09 5193 7081 5299.61 0 7081 13666 13666 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 183.4 81.28% 2019.59 1 2478 2019.65 1951 2122 370452 370452 0.00
crit 42.2 18.72% 4036.99 2 4956 4036.84 3771 4340 170495 170495 0.00
 
 

Action details: stellar_flare

Static Values
  • id:202347
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
Spelldata
  • id:202347
  • name:Stellar Flare
  • school:astral
  • tooltip:Suffering $w2 Astral damage every $t2 sec.
  • description:Burns the target for {$s1=0} Astral damage, and then an additional $o2 damage over {$d=24 seconds}. |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.125000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.087500
  • base_td:0.00
  • base_td_mult:0.82
  • dot_duration:24.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Streaking Star (s) 8851 19.5% 135.1 2.13sec 19652 0 Direct 135.1 16562 33125 19652 18.7%  

Stats details: streaking_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 135.13 135.13 0.00 0.00 0.0000 0.0000 2655649.61 2655649.61 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 109.92 81.34% 16561.81 16184 17803 16561.24 16184 17512 1820523 1820523 0.00
crit 25.21 18.66% 33125.43 32369 35606 33124.33 32369 35435 835127 835127 0.00
 
 

Action details: streaking_stars

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 3344 7.3% 18.1 16.59sec 55484 55590 Direct 18.1 4636 9266 5498 18.6%  
Periodic 227.2 3347 6690 3971 18.7% 99.0%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.05 18.05 227.22 227.22 0.9981 1.3050 1001571.61 1001571.61 0.00 3184.26 55590.36
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.69 81.38% 4635.80 4154 5664 4635.06 4291 5136 68101 68101 0.00
crit 3.36 18.62% 9265.59 8309 11329 9019.32 0 11329 31143 31143 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 184.8 81.32% 3346.57 3 4107 3346.70 3236 3501 618375 618375 0.00
crit 42.4 18.68% 6689.97 33 8213 6689.87 6255 7267 283952 283952 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Simple Action Stats Execute Interval
visions
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:visions
  • harmful:false
  • if_expr:
 
Berserking 2.0 188.78sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.5 149.52sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.46 0.00 0.00 0.00 0.9055 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:251837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:visions
  • harmful:false
  • if_expr:
 
Bountiful Captain's Feast (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:259410
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:visions
  • harmful:false
  • if_expr:
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Battle Potion of Intellect (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:279151
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 7.8 58.6 40.8sec 4.5sec 92.92% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:visions
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:11.29%
  • arcanic_pulsar_2:10.59%
  • arcanic_pulsar_3:11.54%
  • arcanic_pulsar_4:11.23%
  • arcanic_pulsar_5:12.87%
  • arcanic_pulsar_6:10.76%
  • arcanic_pulsar_7:11.04%
  • arcanic_pulsar_8:13.59%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 109.8sec 0.0sec 16.24% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:visions
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.24%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Battle-Scarred Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:visions
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Berserking 2.0 0.0 188.7sec 188.7sec 8.12% 8.01% 0.0(0.0) 2.0

Buff details

  • buff initial source:visions
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:visions
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast) 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:visions
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Celestial Alignment 10.0 0.0 30.8sec 30.8sec 39.89% 47.68% 0.0(0.0) 9.6

Buff details

  • buff initial source:visions
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:39.89%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Conch of Dark Whispers 4.3 1.2 60.9sec 45.5sec 23.68% 0.00% 1.2(1.2) 4.0

Buff details

  • buff initial source:visions
  • cooldown name:buff_conch_of_dark_whispers
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Conch of Dark Whispers

Stat Buff details

  • stat:crit_rating
  • amount:913.59

Stack Uptimes

  • conch_of_dark_whispers_1:23.68%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271071
  • name:Conch of Dark Whispers
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc271072=Your spells have a chance to grant you {$271071s1=649} Critical Strike for {$271071d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:visions
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Ignition Mage's Fuse 2.5 0.0 149.8sec 149.8sec 15.76% 0.00% 2.3(2.3) 2.3

Buff details

  • buff initial source:visions
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:366.08

Stack Uptimes

  • ignition_mages_fuse_1:3.24%
  • ignition_mages_fuse_2:3.19%
  • ignition_mages_fuse_3:3.15%
  • ignition_mages_fuse_4:3.11%
  • ignition_mages_fuse_5:3.07%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lunar Empowerment 25.2 60.5 11.8sec 3.5sec 88.39% 99.63% 4.3(4.3) 0.0

Buff details

  • buff initial source:visions
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:28.52%
  • lunar_empowerment_2:35.78%
  • lunar_empowerment_3:24.10%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Moonkin Form 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:visions
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Nature's Balance 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 399.0(399.0) 0.0

Buff details

  • buff initial source:visions
  • cooldown name:buff_natures_balance
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.75

Stack Uptimes

  • natures_balance_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202430
  • name:Nature's Balance
  • tooltip:Grants $m3 Astral Power every $m4 sec while in combat or while below 50 Astral Power.
  • description:While in combat you generate $m3 Astral Power every $m4 sec. While out of combat your Astral Power rebalances to 50 instead of depleting to empty.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Overwhelming Power 4.6 3.6 64.1sec 33.2sec 48.71% 0.00% 3.6(50.5) 0.0

Buff details

  • buff initial source:visions
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.39%
  • overwhelming_power_2:1.42%
  • overwhelming_power_3:1.46%
  • overwhelming_power_4:1.51%
  • overwhelming_power_5:1.55%
  • overwhelming_power_6:1.59%
  • overwhelming_power_7:1.64%
  • overwhelming_power_8:1.69%
  • overwhelming_power_9:1.74%
  • overwhelming_power_10:1.79%
  • overwhelming_power_11:1.84%
  • overwhelming_power_12:1.90%
  • overwhelming_power_13:1.96%
  • overwhelming_power_14:2.01%
  • overwhelming_power_15:2.07%
  • overwhelming_power_16:2.14%
  • overwhelming_power_17:2.20%
  • overwhelming_power_18:2.27%
  • overwhelming_power_19:2.34%
  • overwhelming_power_20:2.41%
  • overwhelming_power_21:2.49%
  • overwhelming_power_22:2.56%
  • overwhelming_power_23:2.65%
  • overwhelming_power_24:2.72%
  • overwhelming_power_25:1.38%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Solar Empowerment 24.3 58.4 12.0sec 3.6sec 87.16% 84.30% 0.9(0.9) 0.0

Buff details

  • buff initial source:visions
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:27.01%
  • solar_empowerment_2:40.51%
  • solar_empowerment_3:19.64%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starlord 15.5 51.3 20.0sec 4.5sec 98.13% 93.15% 20.6(20.6) 9.8

Buff details

  • buff initial source:visions
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:14.42%
  • starlord_2:21.59%
  • starlord_3:62.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.3 1.1 60.9sec 45.7sec 23.64% 0.00% 1.1(1.1) 4.1

Buff details

  • buff initial source:visions
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.64%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Vision of Perfection 4.0 0.6 61.1sec 51.3sec 14.14% 0.00% 0.6(0.6) 3.9

Buff details

  • buff initial source:visions
  • cooldown name:buff_vision_of_perfection
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:123.79

Stack Uptimes

  • vision_of_perfection_1:14.14%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:303344
  • name:Vision of Perfection
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc303342=When Vision of Perfection activates, you and {$s1=2} other nearby allies gain {$s2=0} Haste for {$303344d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
visions
starsurge Astral Power 66.7 2669.5 40.0 40.0 1710.3
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 94.87 755.81 (28.70%) 7.97 3.14 0.41%
celestial_alignment Astral Power 2.46 98.47 (3.74%) 40.00 0.00 0.00%
sunfire Astral Power 18.05 54.15 (2.06%) 3.00 0.01 0.02%
shooting_stars Astral Power 45.53 181.80 (6.90%) 3.99 0.34 0.18%
moonfire Astral Power 14.25 42.75 (1.62%) 3.00 0.01 0.02%
stellar_flare Astral Power 12.79 101.95 (3.87%) 7.97 0.36 0.35%
lunar_strike Astral Power 79.74 951.38 (36.12%) 11.93 5.45 0.57%
natures_balance Astral Power 400.01 199.80 (7.59%) 0.50 0.21 0.10%
arcanic_pulsar Astral Power 6.94 83.07 (3.15%) 11.98 0.17 0.20%
vision_of_perfection Astral Power 7.42 164.72 (6.25%) 22.20 12.21 6.90%
Resource RPS-Gain RPS-Loss
Astral Power 8.79 8.91
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 21.51 0.00 96.50
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.1%

Statistics & Data Analysis

Fight Length
Sample Data visions Fight Length
Count 15384
Mean 299.63
Minimum 240.01
Maximum 359.99
Spread ( max - min ) 119.97
Range [ ( max - min ) / 2 * 100% ] 20.02%
DPS
Sample Data visions Damage Per Second
Count 15384
Mean 45489.80
Minimum 38875.37
Maximum 55246.08
Spread ( max - min ) 16370.71
Range [ ( max - min ) / 2 * 100% ] 17.99%
Standard Deviation 2015.3908
5th Percentile 42355.34
95th Percentile 48924.58
( 95th Percentile - 5th Percentile ) 6569.24
Mean Distribution
Standard Deviation 16.2489
95.00% Confidence Intervall ( 45457.96 - 45521.65 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 76
0.1% Error 7541
0.1 Scale Factor Error with Delta=300 34674
0.05 Scale Factor Error with Delta=300 138696
0.01 Scale Factor Error with Delta=300 3467387
Priority Target DPS
Sample Data visions Priority Target Damage Per Second
Count 15384
Mean 45489.80
Minimum 38875.37
Maximum 55246.08
Spread ( max - min ) 16370.71
Range [ ( max - min ) / 2 * 100% ] 17.99%
Standard Deviation 2015.3908
5th Percentile 42355.34
95th Percentile 48924.58
( 95th Percentile - 5th Percentile ) 6569.24
Mean Distribution
Standard Deviation 16.2489
95.00% Confidence Intervall ( 45457.96 - 45521.65 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 76
0.1% Error 7541
0.1 Scale Factor Error with Delta=300 34674
0.05 Scale Factor Error with Delta=300 138696
0.01 Scale Factor Error with Delta=300 3467387
DPS(e)
Sample Data visions Damage Per Second (Effective)
Count 15384
Mean 45489.80
Minimum 38875.37
Maximum 55246.08
Spread ( max - min ) 16370.71
Range [ ( max - min ) / 2 * 100% ] 17.99%
Damage
Sample Data visions Damage
Count 15384
Mean 13630527.84
Minimum 9726673.73
Maximum 18857804.46
Spread ( max - min ) 9131130.73
Range [ ( max - min ) / 2 * 100% ] 33.50%
DTPS
Sample Data visions Damage Taken Per Second
Count 15384
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data visions Healing Per Second
Count 15384
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data visions Healing Per Second (Effective)
Count 15384
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data visions Heal
Count 15384
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data visions Healing Taken Per Second
Count 15384
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data visions Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data visionsTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data visions Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
E 1.00 potion,if=buff.ca_inc.remains>6&active_enemies=1
0.00 potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
0.00 blood_fury,if=buff.ca_inc.up
F 2.00 berserking,if=buff.ca_inc.up
0.00 arcane_torrent,if=buff.ca_inc.up
0.00 lights_judgment,if=buff.ca_inc.up
0.00 fireblood,if=buff.ca_inc.up
0.00 ancestral_call,if=buff.ca_inc.up
0.00 use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
0.00 use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
0.00 use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
0.00 use_item,name=tidestorm_codex,if=equipped.165576
G 2.45 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams
0.00 purifying_blast
0.00 ripple_in_space
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
0.00 worldvein_resonance
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
H 2.46 celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
0.00 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
I 4.71 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
0.00 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
J 66.74 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
K 3.73 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
L 2.97 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
M 13.61 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
N 11.28 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
O 12.79 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
P 80.02 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Q 94.12 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
R 0.71 sunfire

Sample Sequence

0123456789ACDJNMOHFGJQJQPJQPQJQPQMQPNQPIJQJOQPJQPQPQJQPJQPJMQPQRQIJNQPJQPJOQPJQPJQPQPMJPNJQPJQPEJOQPJQPKPQJPNQJPQQQJMOPQQPQJPJPNPQJMQJQPKPOQQQJPJPQNJPQQQJMPQQQQQJOPJPQNQHGJMQPQPJQPQJQPJOQPJMQNQPJQPJKPPPJQPJQPOJQNPMPQQQQIJFJQPJQKPJPPOJNQPPQQJPPJMPQJPJQPQOQJNQPJQJKPPJQPJQPPJQNPOJMQPJQPPJQPPPQQQJJ

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask visions 58.0/100: 58% astral_power
Pre precombat 1 food visions 58.0/100: 58% astral_power
Pre precombat 2 augmentation visions 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 9 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power battle_potion_of_intellect
0:00.000 default J starsurge Fluffy_Pillow 66.0/100: 66% astral_power battle_potion_of_intellect
0:01.239 default N moonfire Fluffy_Pillow 26.5/100: 27% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:02.165 default M sunfire Fluffy_Pillow 30.0/100: 30% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:03.089 default O stellar_flare Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:04.014 default H celestial_alignment Fluffy_Pillow 42.5/100: 43% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:04.820 default F berserking Fluffy_Pillow 83.0/100: 83% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:04.820 default G use_items Fluffy_Pillow 83.0/100: 83% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
0:04.820 default J starsurge Fluffy_Pillow 83.0/100: 83% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect, ignition_mages_fuse
0:05.574 default Q solar_wrath Fluffy_Pillow 43.5/100: 44% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), battle_potion_of_intellect, ignition_mages_fuse
0:06.329 default J starsurge Fluffy_Pillow 52.0/100: 52% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), battle_potion_of_intellect, ignition_mages_fuse
0:07.084 default Q solar_wrath Fluffy_Pillow 30.5/100: 31% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), vision_of_perfection, battle_potion_of_intellect, ignition_mages_fuse
0:07.838 default P lunar_strike Fluffy_Pillow 39.0/100: 39% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), vision_of_perfection, battle_potion_of_intellect, ignition_mages_fuse
0:08.670 default J starsurge Fluffy_Pillow 51.5/100: 52% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), vision_of_perfection, battle_potion_of_intellect, ignition_mages_fuse
0:09.425 default Q solar_wrath Fluffy_Pillow 16.0/100: 16% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), vision_of_perfection, battle_potion_of_intellect, ignition_mages_fuse(2)
0:10.180 default P lunar_strike Fluffy_Pillow 24.5/100: 25% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), vision_of_perfection, battle_potion_of_intellect, ignition_mages_fuse(2)
0:10.979 default Q solar_wrath Fluffy_Pillow 37.0/100: 37% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), vision_of_perfection, battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.734 default J starsurge Fluffy_Pillow 45.5/100: 46% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), vision_of_perfection, battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.488 default Q solar_wrath Fluffy_Pillow 6.0/100: 6% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), vision_of_perfection, battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.243 default P lunar_strike Fluffy_Pillow 14.5/100: 14% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), vision_of_perfection, battle_potion_of_intellect, ignition_mages_fuse(3)
0:14.012 default Q solar_wrath Fluffy_Pillow 27.0/100: 27% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), vision_of_perfection, battle_potion_of_intellect, ignition_mages_fuse(3)
0:14.767 default M sunfire Fluffy_Pillow 35.5/100: 36% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), vision_of_perfection, battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.522 default Q solar_wrath Fluffy_Pillow 43.0/100: 43% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), vision_of_perfection, battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.276 default P lunar_strike Fluffy_Pillow 51.5/100: 52% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), vision_of_perfection, battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.045 default N moonfire Fluffy_Pillow 64.0/100: 64% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse(4)
0:17.800 default Q solar_wrath Fluffy_Pillow 71.5/100: 72% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse(4)
0:18.555 default P lunar_strike Fluffy_Pillow 80.0/100: 80% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.378 default I cancel_buff Fluffy_Pillow 96.5/100: 97% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.378 default J starsurge Fluffy_Pillow 96.5/100: 97% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.131 default Q solar_wrath Fluffy_Pillow 57.0/100: 57% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.886 default J starsurge Fluffy_Pillow 65.5/100: 66% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), starlord, battle_potion_of_intellect, ignition_mages_fuse(5)
0:21.640 default O stellar_flare Fluffy_Pillow 40.0/100: 40% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), vision_of_perfection, battle_potion_of_intellect, ignition_mages_fuse(5)
0:22.396 default Q solar_wrath Fluffy_Pillow 52.5/100: 53% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), vision_of_perfection, battle_potion_of_intellect, ignition_mages_fuse(5)
0:23.151 default P lunar_strike Fluffy_Pillow 61.0/100: 61% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), starlord(2), overwhelming_power(24), vision_of_perfection, ignition_mages_fuse(5)
0:23.905 default J starsurge Fluffy_Pillow 73.5/100: 74% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), starlord(2), overwhelming_power(24), vision_of_perfection, ignition_mages_fuse(5)
0:24.660 default Q solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(23), vision_of_perfection, ignition_mages_fuse(5)
0:25.416 default P lunar_strike Fluffy_Pillow 42.5/100: 43% astral_power bloodlust, arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(22), vision_of_perfection
0:26.299 default Q solar_wrath Fluffy_Pillow 55.5/100: 56% astral_power bloodlust, arcanic_pulsar(8), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(21), vision_of_perfection
0:27.053 default P lunar_strike Fluffy_Pillow 68.0/100: 68% astral_power bloodlust, arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(20), vision_of_perfection
0:27.941 default Q solar_wrath Fluffy_Pillow 84.5/100: 85% astral_power bloodlust, arcanic_pulsar(8), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(20), vision_of_perfection
0:28.697 default J starsurge Fluffy_Pillow 97.0/100: 97% astral_power bloodlust, arcanic_pulsar(8), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(19), vision_of_perfection
0:29.452 default Q solar_wrath Fluffy_Pillow 69.5/100: 70% astral_power bloodlust, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(18), vision_of_perfection
0:30.209 default P lunar_strike Fluffy_Pillow 78.0/100: 78% astral_power bloodlust, celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(17), vision_of_perfection
0:31.108 default J starsurge Fluffy_Pillow 94.5/100: 95% astral_power bloodlust, celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(16), vision_of_perfection
0:31.863 default Q solar_wrath Fluffy_Pillow 55.0/100: 55% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(16)
0:32.616 default P lunar_strike Fluffy_Pillow 63.5/100: 64% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(15)
0:33.533 default J starsurge Fluffy_Pillow 90.0/100: 90% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(14), vision_of_perfection
0:34.289 default M sunfire Fluffy_Pillow 50.5/100: 51% astral_power bloodlust, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(13), vision_of_perfection
0:35.044 default Q solar_wrath Fluffy_Pillow 54.0/100: 54% astral_power bloodlust, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(12), vision_of_perfection
0:35.799 default P lunar_strike Fluffy_Pillow 62.5/100: 63% astral_power bloodlust, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(12), vision_of_perfection
0:36.714 default Q solar_wrath Fluffy_Pillow 75.0/100: 75% astral_power bloodlust, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(11), vision_of_perfection
0:37.468 default R sunfire Fluffy_Pillow 83.5/100: 84% astral_power bloodlust, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(10), vision_of_perfection
0:38.224 default Q solar_wrath Fluffy_Pillow 87.0/100: 87% astral_power bloodlust, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(9), vision_of_perfection
0:38.978 default I cancel_buff Fluffy_Pillow 95.5/100: 96% astral_power bloodlust, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(9), vision_of_perfection
0:38.978 default J starsurge Fluffy_Pillow 95.5/100: 96% astral_power bloodlust, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), torrent_of_elements, overwhelming_power(9), vision_of_perfection
0:39.771 default N moonfire Fluffy_Pillow 56.5/100: 56% astral_power bloodlust, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(8), vision_of_perfection
0:40.541 default Q solar_wrath Fluffy_Pillow 60.0/100: 60% astral_power bloodlust, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(7), vision_of_perfection
0:41.293 default P lunar_strike Fluffy_Pillow 68.5/100: 69% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), starlord, torrent_of_elements, overwhelming_power(6), vision_of_perfection
0:42.578 default J starsurge Fluffy_Pillow 81.0/100: 81% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(5), vision_of_perfection
0:43.591 default Q solar_wrath Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(4), conch_of_dark_whispers
0:44.442 default P lunar_strike Fluffy_Pillow 54.5/100: 55% astral_power arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), starlord(2), torrent_of_elements, overwhelming_power(3), conch_of_dark_whispers
0:45.723 default J starsurge Fluffy_Pillow 81.0/100: 81% astral_power arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(2), vision_of_perfection, conch_of_dark_whispers
0:46.717 default O stellar_flare Fluffy_Pillow 46.0/100: 46% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power, vision_of_perfection, conch_of_dark_whispers
0:47.688 default Q solar_wrath Fluffy_Pillow 54.5/100: 55% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), vision_of_perfection, conch_of_dark_whispers
0:48.516 default P lunar_strike Fluffy_Pillow 63.0/100: 63% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), vision_of_perfection, conch_of_dark_whispers
0:49.758 default J starsurge Fluffy_Pillow 76.0/100: 76% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), vision_of_perfection, conch_of_dark_whispers
0:50.731 default Q solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), vision_of_perfection, conch_of_dark_whispers
0:51.560 default P lunar_strike Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(3), starlord(3), vision_of_perfection, conch_of_dark_whispers
0:52.799 default J starsurge Fluffy_Pillow 58.0/100: 58% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), starlord(3), vision_of_perfection, conch_of_dark_whispers
0:53.774 default Q solar_wrath Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), vision_of_perfection, conch_of_dark_whispers
0:54.602 default P lunar_strike Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(3), starlord(3), vision_of_perfection, conch_of_dark_whispers
0:55.843 default Q solar_wrath Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), starlord(3), conch_of_dark_whispers
0:56.832 default P lunar_strike Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), starlord(3), conch_of_dark_whispers
0:58.091 default M sunfire Fluffy_Pillow 61.5/100: 62% astral_power arcanic_pulsar(7), lunar_empowerment, starlord(3), conch_of_dark_whispers
0:59.226 default J starsurge Fluffy_Pillow 65.0/100: 65% astral_power arcanic_pulsar(7), lunar_empowerment
1:00.465 default P lunar_strike Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment, starlord
1:01.997 default N moonfire Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord
1:03.200 default J starsurge Fluffy_Pillow 47.0/100: 47% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord
1:04.402 default Q solar_wrath Fluffy_Pillow 19.5/100: 20% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2)
1:05.266 default P lunar_strike Fluffy_Pillow 28.5/100: 28% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements
1:06.561 default J starsurge Fluffy_Pillow 49.0/100: 49% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), torrent_of_elements
1:07.576 default Q solar_wrath Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements
1:08.416 default P lunar_strike Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements
1:09.675 default E potion Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, vision_of_perfection
1:09.675 default J starsurge Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, vision_of_perfection, battle_potion_of_intellect
1:10.650 default O stellar_flare Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, vision_of_perfection, battle_potion_of_intellect
1:11.622 default Q solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, vision_of_perfection, battle_potion_of_intellect
1:12.451 default P lunar_strike Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, vision_of_perfection, battle_potion_of_intellect
1:13.690 default J starsurge Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, vision_of_perfection, battle_potion_of_intellect
1:14.663 default Q solar_wrath Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, vision_of_perfection, battle_potion_of_intellect
1:15.491 default P lunar_strike Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, vision_of_perfection, battle_potion_of_intellect
1:16.731 default K sunfire Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, vision_of_perfection, battle_potion_of_intellect
1:17.705 default P lunar_strike Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, vision_of_perfection, battle_potion_of_intellect
1:19.133 default Q solar_wrath Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), torrent_of_elements, vision_of_perfection, battle_potion_of_intellect
1:20.084 default J starsurge Fluffy_Pillow 55.0/100: 55% astral_power arcanic_pulsar(3), battle_potion_of_intellect
1:21.323 default P lunar_strike Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord, battle_potion_of_intellect
1:22.853 default N moonfire Fluffy_Pillow 29.0/100: 29% astral_power arcanic_pulsar(4), solar_empowerment, starlord, battle_potion_of_intellect
1:24.055 default Q solar_wrath Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(4), solar_empowerment, starlord, battle_potion_of_intellect
1:25.078 default J starsurge Fluffy_Pillow 41.5/100: 42% astral_power arcanic_pulsar(4), starlord, battle_potion_of_intellect
1:26.279 default P lunar_strike Fluffy_Pillow 6.5/100: 7% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(2), battle_potion_of_intellect
1:27.768 default Q solar_wrath Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(5), solar_empowerment, starlord(2), battle_potion_of_intellect
1:28.761 default Q solar_wrath Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(5), starlord(2), battle_potion_of_intellect
1:29.928 default Q solar_wrath Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(5), starlord(2), battle_potion_of_intellect
1:31.097 default J starsurge Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(5), starlord(2), battle_potion_of_intellect
1:32.264 default M sunfire Fluffy_Pillow 6.5/100: 7% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, battle_potion_of_intellect
1:33.401 default O stellar_flare Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, battle_potion_of_intellect
1:34.537 default P lunar_strike Fluffy_Pillow 19.0/100: 19% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, battle_potion_of_intellect
1:35.984 default Q solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), torrent_of_elements
1:36.951 default Q solar_wrath Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(6), starlord(3), torrent_of_elements
1:38.086 default P lunar_strike Fluffy_Pillow 53.0/100: 53% astral_power arcanic_pulsar(6), lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(24)
1:39.414 default Q solar_wrath Fluffy_Pillow 66.0/100: 66% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(23)
1:40.303 default J starsurge Fluffy_Pillow 74.5/100: 75% astral_power arcanic_pulsar(6), lunar_empowerment, torrent_of_elements, overwhelming_power(22)
1:41.447 default P lunar_strike Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(21)
1:42.868 default J starsurge Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(20)
1:43.986 default P lunar_strike Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(19)
1:45.376 default N moonfire Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(17)
1:46.476 default P lunar_strike Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(16)
1:47.880 default Q solar_wrath Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(8), solar_empowerment(3), starlord(2), overwhelming_power(15), conch_of_dark_whispers
1:48.819 default J starsurge Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(2), overwhelming_power(14), conch_of_dark_whispers
1:49.928 default M sunfire Fluffy_Pillow 24.0/100: 24% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(13), conch_of_dark_whispers
1:50.870 default Q solar_wrath Fluffy_Pillow 31.5/100: 32% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(12), conch_of_dark_whispers
1:51.675 default J starsurge Fluffy_Pillow 40.0/100: 40% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(11), conch_of_dark_whispers
1:52.624 default Q solar_wrath Fluffy_Pillow 1.0/100: 1% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(10), conch_of_dark_whispers
1:53.435 default P lunar_strike Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(25), conch_of_dark_whispers
1:54.586 default K sunfire Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(24), conch_of_dark_whispers
1:55.494 default P lunar_strike Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(23), conch_of_dark_whispers
1:56.825 default O stellar_flare Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar, solar_empowerment(2), starlord(3), overwhelming_power(22), conch_of_dark_whispers
1:57.877 default Q solar_wrath Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar, solar_empowerment(2), starlord(3), overwhelming_power(21), conch_of_dark_whispers
1:58.772 default Q solar_wrath Fluffy_Pillow 60.0/100: 60% astral_power arcanic_pulsar, solar_empowerment, starlord(3), overwhelming_power(20), conch_of_dark_whispers
1:59.671 default Q solar_wrath Fluffy_Pillow 68.5/100: 69% astral_power arcanic_pulsar, starlord(3), overwhelming_power(19), conch_of_dark_whispers
2:00.733 default J starsurge Fluffy_Pillow 77.0/100: 77% astral_power arcanic_pulsar, overwhelming_power(18), conch_of_dark_whispers
2:01.892 default P lunar_strike Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(17), conch_of_dark_whispers
2:03.332 default J starsurge Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(2), solar_empowerment, starlord, overwhelming_power(15)
2:04.470 default P lunar_strike Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(14)
2:05.885 default Q solar_wrath Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(2), overwhelming_power(13)
2:06.834 default N moonfire Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(3), solar_empowerment, starlord(2), overwhelming_power(25)
2:07.903 default J starsurge Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(3), solar_empowerment, starlord(2), overwhelming_power(24)
2:08.976 default P lunar_strike Fluffy_Pillow 1.5/100: 2% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(23)
2:10.305 default Q solar_wrath Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(4), solar_empowerment(3), starlord(3), overwhelming_power(21), conch_of_dark_whispers
2:11.201 default Q solar_wrath Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), overwhelming_power(20), conch_of_dark_whispers
2:12.101 default Q solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(4), solar_empowerment, starlord(3), overwhelming_power(19), conch_of_dark_whispers
2:13.001 default J starsurge Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(4), starlord(3), overwhelming_power(18), conch_of_dark_whispers
2:14.066 default M sunfire Fluffy_Pillow 1.0/100: 1% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(17), conch_of_dark_whispers
2:15.134 default P lunar_strike Fluffy_Pillow 5.0/100: 5% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(16), conch_of_dark_whispers
2:16.498 default Q solar_wrath Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), overwhelming_power(15), conch_of_dark_whispers
2:17.413 default Q solar_wrath Fluffy_Pillow 26.5/100: 27% astral_power arcanic_pulsar(5), starlord(3), overwhelming_power(14), conch_of_dark_whispers
2:18.494 default Q solar_wrath Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(5), starlord(3), overwhelming_power(13), conch_of_dark_whispers
2:19.577 default Q solar_wrath Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(5), starlord(3), overwhelming_power(12), conch_of_dark_whispers
2:20.663 default Q solar_wrath Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(5), starlord(3), overwhelming_power(11), conch_of_dark_whispers
2:21.754 default J starsurge Fluffy_Pillow 61.5/100: 62% astral_power arcanic_pulsar(5), overwhelming_power(10), conch_of_dark_whispers
2:22.947 default O stellar_flare Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(9), conch_of_dark_whispers
2:24.111 default P lunar_strike Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(7), conch_of_dark_whispers
2:25.605 default J starsurge Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(6), solar_empowerment, starlord, overwhelming_power(6), conch_of_dark_whispers
2:26.782 default P lunar_strike Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(5), conch_of_dark_whispers
2:28.241 default Q solar_wrath Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(7), solar_empowerment(3), starlord(2), overwhelming_power(3), conch_of_dark_whispers
2:29.223 default N moonfire Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(2), overwhelming_power(2), conch_of_dark_whispers
2:30.384 default Q solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(2), overwhelming_power, conch_of_dark_whispers
2:31.375 default H celestial_alignment Fluffy_Pillow 46.5/100: 47% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), conch_of_dark_whispers
2:32.390 default G use_items Fluffy_Pillow 87.5/100: 88% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), conch_of_dark_whispers
2:32.390 default J starsurge Fluffy_Pillow 87.5/100: 88% astral_power arcanic_pulsar(7), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), conch_of_dark_whispers, ignition_mages_fuse
2:33.364 default M sunfire Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), conch_of_dark_whispers, ignition_mages_fuse
2:34.311 default Q solar_wrath Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), conch_of_dark_whispers, ignition_mages_fuse
2:35.116 default P lunar_strike Fluffy_Pillow 60.0/100: 60% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), conch_of_dark_whispers, ignition_mages_fuse
2:36.322 default Q solar_wrath Fluffy_Pillow 73.0/100: 73% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), conch_of_dark_whispers, ignition_mages_fuse
2:37.129 default P lunar_strike Fluffy_Pillow 81.5/100: 82% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment(3), starlord(3), ignition_mages_fuse(2)
2:38.286 default J starsurge Fluffy_Pillow 94.5/100: 95% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), ignition_mages_fuse(2)
2:39.194 default Q solar_wrath Fluffy_Pillow 67.0/100: 67% astral_power celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), ignition_mages_fuse(2)
2:39.966 default P lunar_strike Fluffy_Pillow 75.5/100: 76% astral_power celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), ignition_mages_fuse(2)
2:41.125 default Q solar_wrath Fluffy_Pillow 88.0/100: 88% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), ignition_mages_fuse(3)
2:41.879 default J starsurge Fluffy_Pillow 96.5/100: 97% astral_power celestial_alignment, lunar_empowerment(2), ignition_mages_fuse(3)
2:42.828 default Q solar_wrath Fluffy_Pillow 57.5/100: 57% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord, ignition_mages_fuse(3)
2:43.614 default P lunar_strike Fluffy_Pillow 66.0/100: 66% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), starlord, ignition_mages_fuse(3)
2:44.791 default J starsurge Fluffy_Pillow 78.5/100: 79% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord, ignition_mages_fuse(4)
2:45.681 default O stellar_flare Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), ignition_mages_fuse(4)
2:46.547 default Q solar_wrath Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(25), ignition_mages_fuse(4)
2:47.302 default P lunar_strike Fluffy_Pillow 60.5/100: 61% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), starlord(2), overwhelming_power(24), ignition_mages_fuse(4)
2:48.323 default J starsurge Fluffy_Pillow 73.0/100: 73% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), starlord(2), overwhelming_power(23), ignition_mages_fuse(4)
2:49.128 default M sunfire Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(22), ignition_mages_fuse(5)
2:49.886 default Q solar_wrath Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(22), ignition_mages_fuse(5)
2:50.641 default N moonfire Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(21), ignition_mages_fuse(5)
2:51.402 default Q solar_wrath Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(20), ignition_mages_fuse(5)
2:52.165 default P lunar_strike Fluffy_Pillow 57.5/100: 57% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), starlord(3), overwhelming_power(19), ignition_mages_fuse(5)
2:53.140 default J starsurge Fluffy_Pillow 70.0/100: 70% astral_power arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(18)
2:54.067 default Q solar_wrath Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(17)
2:54.859 default P lunar_strike Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), overwhelming_power(17)
2:56.042 default J starsurge Fluffy_Pillow 56.0/100: 56% astral_power arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(15)
2:56.976 default K sunfire Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(15)
2:57.914 default P lunar_strike Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(5), lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(14)
2:59.290 default P lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(12)
3:00.677 default P lunar_strike Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(11)
3:02.068 default J starsurge Fluffy_Pillow 63.0/100: 63% astral_power arcanic_pulsar(5), solar_empowerment(2), overwhelming_power(9)
3:03.267 default Q solar_wrath Fluffy_Pillow 24.0/100: 24% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord, overwhelming_power(8)
3:04.260 default P lunar_strike Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(7)
3:05.751 default J starsurge Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord, overwhelming_power(6)
3:06.928 default Q solar_wrath Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(2), overwhelming_power(5)
3:07.903 default P lunar_strike Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(4), conch_of_dark_whispers
3:09.370 default O stellar_flare Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(2), overwhelming_power(2), conch_of_dark_whispers
3:10.530 default J starsurge Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(2), overwhelming_power, conch_of_dark_whispers
3:11.696 default Q solar_wrath Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), conch_of_dark_whispers
3:12.663 default N moonfire Fluffy_Pillow 18.0/100: 18% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), conch_of_dark_whispers
3:13.799 default P lunar_strike Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers
3:15.245 default M sunfire Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers
3:16.381 default P lunar_strike Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers
3:17.829 default Q solar_wrath Fluffy_Pillow 55.5/100: 56% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), torrent_of_elements, conch_of_dark_whispers
3:18.797 default Q solar_wrath Fluffy_Pillow 64.5/100: 65% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), torrent_of_elements, conch_of_dark_whispers
3:19.764 default Q solar_wrath Fluffy_Pillow 73.0/100: 73% astral_power arcanic_pulsar(8), starlord(3), torrent_of_elements, conch_of_dark_whispers
3:20.900 default Q solar_wrath Fluffy_Pillow 81.5/100: 82% astral_power arcanic_pulsar(8), starlord(3), torrent_of_elements, conch_of_dark_whispers
3:22.038 default I cancel_buff Fluffy_Pillow 90.5/100: 91% astral_power arcanic_pulsar(8), starlord(3), torrent_of_elements, conch_of_dark_whispers
3:22.038 default J starsurge Fluffy_Pillow 90.5/100: 91% astral_power arcanic_pulsar(8), torrent_of_elements, conch_of_dark_whispers
3:23.276 default F berserking Fluffy_Pillow 67.5/100: 68% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, torrent_of_elements
3:23.276 default J starsurge Fluffy_Pillow 67.5/100: 68% astral_power berserking, celestial_alignment, lunar_empowerment, solar_empowerment, starlord, torrent_of_elements
3:24.225 default Q solar_wrath Fluffy_Pillow 28.0/100: 28% astral_power berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements
3:25.011 default P lunar_strike Fluffy_Pillow 36.5/100: 37% astral_power berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), torrent_of_elements
3:26.188 default J starsurge Fluffy_Pillow 49.0/100: 49% astral_power berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements
3:27.111 default Q solar_wrath Fluffy_Pillow 10.0/100: 10% astral_power berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements
3:27.876 default K sunfire Fluffy_Pillow 22.5/100: 23% astral_power berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements
3:28.777 default P lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power berserking, arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements
3:30.093 default J starsurge Fluffy_Pillow 43.0/100: 43% astral_power berserking, arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements
3:31.128 default P lunar_strike Fluffy_Pillow 3.5/100: 4% astral_power berserking, arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements
3:32.445 default P lunar_strike Fluffy_Pillow 16.5/100: 17% astral_power berserking, arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements
3:33.761 default O stellar_flare Fluffy_Pillow 29.5/100: 30% astral_power berserking, arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements
3:34.794 default J starsurge Fluffy_Pillow 42.0/100: 42% astral_power berserking, arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements
3:35.827 default N moonfire Fluffy_Pillow 2.5/100: 3% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements
3:36.961 default Q solar_wrath Fluffy_Pillow 6.5/100: 7% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), torrent_of_elements
3:37.929 default P lunar_strike Fluffy_Pillow 15.0/100: 15% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements
3:39.376 default P lunar_strike Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(24)
3:40.704 default Q solar_wrath Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(23)
3:41.593 default Q solar_wrath Fluffy_Pillow 53.5/100: 54% astral_power arcanic_pulsar(4), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(22)
3:42.486 default J starsurge Fluffy_Pillow 62.0/100: 62% astral_power arcanic_pulsar(4), lunar_empowerment, torrent_of_elements, overwhelming_power(21)
3:43.634 default P lunar_strike Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(20)
3:45.061 default P lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(18)
3:46.496 default J starsurge Fluffy_Pillow 52.5/100: 53% astral_power arcanic_pulsar(5), solar_empowerment, starlord, overwhelming_power(17)
3:47.626 default M sunfire Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(16)
3:48.729 default P lunar_strike Fluffy_Pillow 17.0/100: 17% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(24)
3:50.095 default Q solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(2), overwhelming_power(22)
3:51.013 default J starsurge Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(6), solar_empowerment, starlord(2), overwhelming_power(21)
3:52.095 default P lunar_strike Fluffy_Pillow 3.5/100: 4% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(20)
3:53.442 default J starsurge Fluffy_Pillow 74.5/100: 75% astral_power arcanic_pulsar(7), celestial_alignment, solar_empowerment(2), starlord(3), overwhelming_power(19), vision_of_perfection
3:54.351 default Q solar_wrath Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(18), vision_of_perfection
3:55.127 default P lunar_strike Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(17), vision_of_perfection
3:56.295 default Q solar_wrath Fluffy_Pillow 60.5/100: 61% astral_power arcanic_pulsar(8), celestial_alignment, solar_empowerment(2), starlord(3), overwhelming_power(16), vision_of_perfection
3:57.076 default O stellar_flare Fluffy_Pillow 69.0/100: 69% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(15), vision_of_perfection
3:57.998 default Q solar_wrath Fluffy_Pillow 77.5/100: 78% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(15), vision_of_perfection
3:58.783 default J starsurge Fluffy_Pillow 90.0/100: 90% astral_power arcanic_pulsar(8), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(14), vision_of_perfection
3:59.709 default N moonfire Fluffy_Pillow 62.5/100: 63% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(13), vision_of_perfection
4:00.637 default Q solar_wrath Fluffy_Pillow 66.0/100: 66% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(12), vision_of_perfection
4:01.430 default P lunar_strike Fluffy_Pillow 74.5/100: 75% astral_power celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(25), vision_of_perfection
4:02.566 default J starsurge Fluffy_Pillow 91.5/100: 92% astral_power celestial_alignment, lunar_empowerment, overwhelming_power(24)
4:03.555 default Q solar_wrath Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, overwhelming_power(24)
4:04.370 default J starsurge Fluffy_Pillow 64.5/100: 65% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord, overwhelming_power(23)
4:05.333 default K sunfire Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(22)
4:06.273 default P lunar_strike Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment, starlord(2), overwhelming_power(21)
4:07.655 default P lunar_strike Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(20)
4:09.039 default J starsurge Fluffy_Pillow 63.0/100: 63% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(18)
4:10.134 default Q solar_wrath Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(17)
4:11.043 default P lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(16)
4:12.409 default J starsurge Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(15)
4:13.486 default Q solar_wrath Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(14)
4:14.404 default P lunar_strike Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(13)
4:15.783 default P lunar_strike Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(12)
4:17.168 default J starsurge Fluffy_Pillow 52.0/100: 52% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(3), overwhelming_power(10)
4:18.264 default Q solar_wrath Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(9)
4:19.199 default N moonfire Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(8)
4:20.304 default P lunar_strike Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(7)
4:21.714 default O stellar_flare Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(6)
4:22.826 default J starsurge Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), overwhelming_power(5)
4:24.041 default M sunfire Fluffy_Pillow 16.0/100: 16% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord, overwhelming_power(3)
4:25.230 default Q solar_wrath Fluffy_Pillow 23.5/100: 24% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(3), starlord, overwhelming_power(2)
4:26.245 default P lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(6), lunar_empowerment(2), solar_empowerment(2), starlord, overwhelming_power(24)
4:27.649 default J starsurge Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord, overwhelming_power(23)
4:28.758 default Q solar_wrath Fluffy_Pillow 6.0/100: 6% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(3), starlord(2), overwhelming_power(22)
4:29.676 default P lunar_strike Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(7), lunar_empowerment(3), solar_empowerment(2), starlord(2), overwhelming_power(21)
4:31.056 default P lunar_strike Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(19)
4:32.446 default J starsurge Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(18)
4:33.540 default Q solar_wrath Fluffy_Pillow 1.0/100: 1% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(3), starlord(3), overwhelming_power(17)
4:34.448 default P lunar_strike Fluffy_Pillow 9.5/100: 10% astral_power arcanic_pulsar(8), lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(16)
4:35.815 default P lunar_strike Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(15)
4:37.184 default P lunar_strike Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(24)
4:38.514 default Q solar_wrath Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), overwhelming_power(23)
4:39.403 default Q solar_wrath Fluffy_Pillow 57.0/100: 57% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(22)
4:40.297 default Q solar_wrath Fluffy_Pillow 69.5/100: 70% astral_power arcanic_pulsar(8), starlord(3), torrent_of_elements, overwhelming_power(21)
4:41.351 default J starsurge Fluffy_Pillow 78.5/100: 79% astral_power arcanic_pulsar(8), lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(20)
4:42.406 default J starsurge Fluffy_Pillow 51.0/100: 51% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(19)

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 16238 14762 13761
Intellect 1467 -3 13346 11714 9693 (6045)
Spirit 0 0 0 0 0
Health 324760 295240 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 13346 11714 0
Crit 15.68% 15.68% 769
Haste 21.51% 21.51% 1463
Damage / Heal Versatility 5.88% 5.88% 500
ManaReg per Second 2378 640 0
Attack Power 13880 12183 0
Mastery 55.20% 55.20% 2005
Armor 2962 2962 2962
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 447.00
Local Head Hood of the Slithering Loa
ilevel: 450, stats: { 407 Armor, +1145 AgiInt, +2255 Sta }
Local Neck Heart of Azeroth
ilevel: 463, stats: { +325 Haste, +325 Crit, +325 Mastery, +719 Sta, +382 StrAgiInt }
Local Shoulders Gorak Tul's Mantle
ilevel: 450, stats: { 376 Armor, +859 AgiInt, +1691 Sta }
Local Chest Spymaster's Wrap
ilevel: 450, stats: { 501 Armor, +1145 AgiInt, +2255 Sta }
Local Waist Beloved Monarch's Waistwrap
ilevel: 445, stats: { 271 Armor, +431 AgiInt, +789 Sta, +147 Mastery, +82 Crit }
Local Legs Leggings of the Stormborn
ilevel: 445, stats: { 422 Armor, +575 AgiInt, +1053 Sta, +179 Vers, +126 Crit }
Local Feet Ancient Tempest Striders
ilevel: 445, stats: { 331 Armor, +431 AgiInt, +789 Sta, +134 Mastery, +95 Haste }
Local Wrists Tideblood Bracers
ilevel: 445, stats: { 211 Armor, +323 AgiInt, +592 Sta, +105 Haste, +66 Crit }
Local Hands Gloves of Incomparable Beauty
ilevel: 445, stats: { 301 Armor, +431 AgiInt, +789 Sta, +134 Haste, +95 Mastery }
Local Finger1 Boralus Noble's Seal
ilevel: 445, stats: { +592 Sta, +369 Mastery, +169 Haste }, enchant: { +60 Haste }
Local Finger2 Cursed Lover's Ring
ilevel: 445, stats: { +592 Sta, +307 Haste, +230 Vers }, enchant: { +60 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 445, stats: { +546 Int }
Local Trinket2 Conch of Dark Whispers
ilevel: 445, stats: { +546 Int }
Local Back Cloak of Ill Tidings
ilevel: 445, stats: { 142 Armor, +323 StrAgiInt, +592 Sta, +110 Mastery, +61 Crit }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 445, weapon: { 661 - 896, 3.6 }, stats: { +575 Int, +1053 Sta, +109 Haste, +109 Crit, +109 Mastery, +1981 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="visions"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
talents=1000231
azerite_override=lifespeed:450/heed_my_call:450/overwhelming_power:450/streaking_stars:450/streaking_stars:450/streaking_stars:450/arcanic_pulsar:450/loyal_to_the_end:450/loyal_to_the_end:450

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6&active_enemies=1
actions+=/potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
actions+=/blood_fury,if=buff.ca_inc.up
actions+=/berserking,if=buff.ca_inc.up
actions+=/arcane_torrent,if=buff.ca_inc.up
actions+=/lights_judgment,if=buff.ca_inc.up
actions+=/fireblood,if=buff.ca_inc.up
actions+=/ancestral_call,if=buff.ca_inc.up
actions+=/use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
actions+=/use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
actions+=/use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
actions+=/celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=hood_of_the_slithering_loa,id=159318,ilevel=450
neck=heart_of_azeroth,id=158075,ilevel=463
shoulders=gorak_tuls_mantle,id=159339,ilevel=450
back=cloak_of_ill_tidings,id=168391,ilevel=445
chest=spymasters_wrap,id=155860,ilevel=450
wrists=tideblood_bracers,id=168377,ilevel=445
hands=gloves_of_incomparable_beauty,id=168887,ilevel=445
waist=beloved_monarchs_waistwrap,id=168871,ilevel=445
legs=leggings_of_the_stormborn,id=168378,ilevel=445
feet=ancient_tempest_striders,id=168380,ilevel=445
finger1=boralus_nobles_seal,id=168889,ilevel=445,enchant=60haste
finger2=cursed_lovers_ring,id=168891,ilevel=445,enchant=60haste
trinket1=ignition_mages_fuse,id=159615,ilevel=445
trinket2=conch_of_dark_whispers,id=159620,ilevel=445
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=445,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=447.20
# gear_stamina=13761
# gear_intellect=9693
# gear_crit_rating=769
# gear_haste_rating=1364
# gear_mastery_rating=1289
# gear_versatility_rating=409
# gear_armor=2962

worldvein : 40838 dps

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
40837.8 40837.8 19.9 / 0.049% 4897.7 / 12.0% 5013.2
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.1 8.0 Astral Power 0.00% 58.4 100.0% 100%
Talents
  • 15: Nature's Balance (Balance Druid)
  • 75: Starlord (Balance Druid)
  • 90: Stellar Flare (Balance Druid)
  • 100: Shooting Stars (Balance Druid)
  • Talent Calculator

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
worldvein 40838
Heed My Call 298 (426) 0.7% (1.0%) 8.2 33.10sec 15479 0 Direct 8.2 9128 18252 10830 18.7%  

Stats details: heed_my_call

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.23 8.23 0.00 0.00 0.0000 0.0000 89139.61 89139.61 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.70 81.35% 9128.20 8921 9813 9126.96 0 9813 61117 61117 0.00
crit 1.54 18.65% 18252.43 17842 19626 14392.43 0 19626 28023 28023 0.00
 
 

Action details: heed_my_call

Static Values
  • id:271685
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271685
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:8106.00
  • base_dd_max:8106.00
  • base_dd_mult:1.00
 
    Heed My Call (_aoe) 128 0.3% 8.2 33.10sec 4649 0 Direct 8.2 3912 7825 4649 18.8%  

Stats details: heed_my_call_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.23 8.23 0.00 0.00 0.0000 0.0000 38262.80 38262.80 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.68 81.17% 3911.77 3823 4206 3911.07 0 4206 26133 26133 0.00
crit 1.55 18.83% 7825.22 7646 8411 6204.01 0 8411 12130 12130 0.00
 
 

Action details: heed_my_call_aoe

Static Values
  • id:271686
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:271686
  • name:Heed My Call
  • school:nature
  • tooltip:
  • description:{$@spelldesc263987=Your damaging abilities have a chance to deal {$s1=2204} Nature damage to your target, and {$s2=944} Nature damage to enemies within 3 yards of that target.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:3474.00
  • base_dd_max:3474.00
  • base_dd_mult:1.00
 
Lunar Strike 6035 14.8% 76.7 3.81sec 23550 18147 Direct 76.7 19837 39659 23550 18.7%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 76.71 76.71 0.00 0.00 1.2977 0.0000 1806525.87 1806525.87 0.00 18147.28 18147.28
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 62.34 81.27% 19837.20 10135 25993 19845.75 19080 20895 1236656 1236656 0.00
crit 14.37 18.73% 39659.17 20270 51987 39674.20 34139 45106 569870 569870 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 76.5%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.765000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Moonfire 2975 7.3% 14.0 21.37sec 63475 62753 Direct 14.0 3424 6848 4063 18.7%  
Periodic 222.7 3152 6299 3741 18.7% 98.9%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.02 14.02 222.75 222.75 1.0116 1.3309 890212.65 890212.65 0.00 2865.66 62752.90
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.41 81.34% 3424.14 2981 4364 3426.32 3119 3799 39063 39063 0.00
crit 2.62 18.66% 6847.51 5963 8729 6446.31 0 8729 17916 17916 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 181.1 81.30% 3152.30 2 4063 3153.75 3048 3303 570848 570848 0.00
crit 41.7 18.70% 6298.54 4 8127 6301.22 5828 6818 262386 262386 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=0 + 14.5%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Shooting Stars 956 2.3% 44.5 6.56sec 6428 0 Direct 44.5 5418 10830 6427 18.7%  

Stats details: shooting_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.50 44.50 0.00 0.00 0.0000 0.0000 286027.13 286027.13 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 36.20 81.35% 5417.91 4769 6982 5420.29 5049 5903 196126 196126 0.00
crit 8.30 18.65% 10830.29 9539 13963 10831.79 0 13963 89901 89901 0.00
 
 

Action details: shooting_stars

Static Values
  • id:202497
  • school:astral
  • resource:none
  • range:50000.0
  • travel_speed:0.8000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a chance to call down a falling star, dealing {$202497s1=0} Astral damage and generating ${$202497m2/10} Astral Power.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.360000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Solar Wrath 3337 (5339) 8.2% (13.1%) 92.3 3.18sec 17304 19325 Direct 92.8 9065 18119 10756 18.7%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 92.33 92.85 0.00 0.00 0.8954 0.0000 998645.32 998645.32 0.00 19324.92 19324.92
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.50 81.32% 9064.50 7949 11636 9069.74 8699 9612 684386 684386 0.00
crit 17.34 18.68% 18118.59 15898 23272 18127.70 16307 20868 314260 314260 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=0} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.600000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
    Solar Wrath (solar_empowerment) 2002 4.9% 73.9 3.96sec 8110 0 Direct 73.9 8109 0 8109 0.0%  

Stats details: solar_empowerment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 73.87 73.87 0.00 0.00 0.0000 0.0000 599081.41 599081.41 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.87 100.00% 8109.45 5962 17454 8114.05 6999 9591 599081 599081 0.00
 
 

Action details: solar_empowerment

Static Values
  • id:279729
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:279729
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Solar Empowerment causes Solar Wrath to explode on impact for {$164545s1=20}% additional damage to all nearby enemies.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:6198.00
  • base_dd_max:6198.00
  • base_dd_mult:1.00
 
Starsurge 14008 34.3% 60.9 4.95sec 68820 66017 Direct 60.7 58237 116400 69046 18.6%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 60.89 60.69 0.00 0.00 1.0425 0.0000 4190424.00 4190424.00 0.00 66016.92 66016.92
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 49.41 81.42% 58237.27 51347 74359 58264.51 55895 62008 2877617 2877617 0.00
crit 11.28 18.58% 116400.05 102695 148718 116445.00 103630 143419 1312807 1312807 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:45.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=0} Astral damage. Also grants you Lunar and Solar Empowerment.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.300000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
 
Stellar Flare 1929 4.7% 12.7 23.57sec 45321 44199 Direct 12.7 2873 5740 3411 18.7%  
Periodic 220.2 2042 4082 2424 18.7% 98.1%

Stats details: stellar_flare

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.74 12.74 220.25 220.25 1.0254 1.3345 577283.32 577283.32 0.00 1880.46 44199.01
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.35 81.26% 2873.50 2570 3762 2874.13 2643 3134 29742 29742 0.00
crit 2.39 18.74% 5740.42 5140 7525 5312.76 0 7525 13704 13704 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 179.0 81.29% 2042.16 2 2634 2043.10 1979 2136 365622 365622 0.00
crit 41.2 18.71% 4081.68 23 5267 4083.44 3821 4477 168216 168216 0.00
 
 

Action details: stellar_flare

Static Values
  • id:202347
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
Spelldata
  • id:202347
  • name:Stellar Flare
  • school:astral
  • tooltip:Suffering $w2 Astral damage every $t2 sec.
  • description:Burns the target for {$s1=0} Astral damage, and then an additional $o2 damage over {$d=24 seconds}. |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.125000
  • base_dd_min:0.00
  • base_dd_max:0.00
  • base_dd_mult:0.82
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.087500
  • base_td:0.00
  • base_td_mult:0.82
  • dot_duration:24.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Streaking Star (s) 5857 14.3% 89.7 3.10sec 19433 0 Direct 89.7 16389 32787 19433 18.6%  

Stats details: streaking_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 89.67 89.67 0.00 0.00 0.0000 0.0000 1742634.50 1742634.50 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.03 81.44% 16388.84 16021 17623 16388.75 16021 17320 1196829 1196829 0.00
crit 16.65 18.56% 32787.30 32042 35246 32787.56 32042 35246 545805 545805 0.00
 
 

Action details: streaking_stars

Static Values
  • id:272873
  • school:arcane
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:272873
  • name:Streaking Star
  • school:arcane
  • tooltip:
  • description:{$@spelldesc272871=While Celestial Alignment is active, your damaging spells call a Streaking Star, dealing an additional {$s1=1272} damage when they are not a repeat of the previous ability.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:14034.00
  • base_dd_max:14034.00
  • base_dd_mult:0.82
 
Sunfire 3314 8.1% 18.0 16.51sec 54999 54078 Direct 18.0 4704 9406 5577 18.6%  
Periodic 221.9 3385 6766 4017 18.7% 98.6%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.03 18.03 221.86 221.86 1.0170 1.3323 991843.57 991843.57 0.00 3159.51 54077.94
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.68 81.43% 4703.87 4112 6020 4704.51 4339 5152 69072 69072 0.00
crit 3.35 18.57% 9405.56 8225 12040 9155.37 0 12040 31506 31506 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 180.4 81.31% 3385.45 2 4364 3387.02 3280 3560 610744 610744 0.00
crit 41.5 18.69% 6766.21 17 8729 6769.20 6241 7334 280522 280522 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=0} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Simple Action Stats Execute Interval
worldvein
Battle-Scarred Augmentation (augmentation) 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:270058
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:worldvein
  • harmful:false
  • if_expr:
 
Berserking 2.0 182.58sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.ca_inc.up
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
 
Celestial Alignment 2.0 182.66sec

Stats details: celestial_alignment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.9027 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: celestial_alignment

Static Values
  • id:194223
  • school:astral
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
Spelldata
  • id:194223
  • name:Celestial Alignment
  • school:astral
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
 
Flask of Endless Fathoms (flask) 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:251837
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:worldvein
  • harmful:false
  • if_expr:
 
Bountiful Captain's Feast (food) 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:259410
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:worldvein
  • harmful:false
  • if_expr:
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
 
Battle Potion of Intellect (potion) 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:279151
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Worldvein Resonance 5.5 60.36sec

Stats details: worldvein_resonance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.47 0.00 0.00 0.00 1.1411 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: worldvein_resonance

Static Values
  • id:295186
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • cooldown hasted:false
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:295186
  • name:Worldvein Resonance
  • school:physical
  • tooltip:
  • description:Concentrate energy into the Heart of Azeroth, immediately causing {$s1=2} Lifeblood Shards to erupt from the nearby ground for {$295114d=12 seconds}. $@spellicon295078$@spellname295114 Grants you and any other ally using Worldvein Resonance {$295078s5=55} primary stat while within {$295078s2=8} yds of the Lifeblood Shard. You can benefit from a maximum of {$295137u=4} Lifeblood Shards at a time.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Arcanic Pulsar 7.2 53.5 44.3sec 4.9sec 92.81% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_arcanic_pulsar
  • max_stacks:9
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcanic_pulsar_1:11.55%
  • arcanic_pulsar_2:10.33%
  • arcanic_pulsar_3:10.96%
  • arcanic_pulsar_4:10.72%
  • arcanic_pulsar_5:13.82%
  • arcanic_pulsar_6:10.61%
  • arcanic_pulsar_7:10.78%
  • arcanic_pulsar_8:14.03%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:287790
  • name:Arcanic Pulsar
  • tooltip:Arcane energy is accumulating...
  • description:{$@spelldesc287773=Starsurge's damage is increased by {$s2=715}. Every {$s4=9} Starsurges, gain Celestial Alignment for {$s3=6} sec.}
  • max_stacks:9
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Battle Potion of Intellect 2.0 0.0 188.6sec 0.0sec 16.24% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_battle_potion_of_intellect
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:900.00

Stack Uptimes

  • battle_potion_of_intellect_1:16.24%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279151
  • name:Battle Potion of Intellect
  • tooltip:Intellect increased by $w1.
  • description:Increases your Intellect by {$s1=900} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Battle-Scarred Augmentation 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_battlescarred_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:agility
  • amount:60.00
  • stat:strength
  • amount:60.00
  • stat:intellect
  • amount:60.00

Stack Uptimes

  • battlescarred_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:270058
  • name:Battle-Scarred Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=60} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Berserking 2.0 0.0 182.6sec 182.6sec 8.12% 7.67% 0.0(0.0) 2.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:12.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • berserking_1:8.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=10}%.
  • description:Increases your haste by {$s1=10}% for {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 13.53% 0.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bloodlust_1:13.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Well Fed (bountiful_captains_feast) 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_bountiful_captains_feast
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:100.00

Stack Uptimes

  • bountiful_captains_feast_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:259455
  • name:Well Fed
  • tooltip:Intellect increased by $w1.
  • description:Intellect increased by {$s1=100}. Lasts {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Celestial Alignment 8.2 0.0 37.5sec 37.5sec 25.85% 32.61% 0.0(0.0) 8.1

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_celestial_alignment
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • celestial_alignment_1:25.85%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194223
  • name:Celestial Alignment
  • tooltip:Spell damage increased by {$s1=15}%. Haste increased by {$s3=15}%.
  • description:Celestial bodies align, granting ${{$s5=400}/10} Astral Power, and increasing spell damage by {$s1=15}% and Haste by {$s3=15}% for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:180.00
  • default_chance:0.00%
Conch of Dark Whispers 4.3 1.2 61.1sec 45.6sec 23.65% 0.00% 1.2(1.2) 4.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_conch_of_dark_whispers
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00
  • associated item:Conch of Dark Whispers

Stat Buff details

  • stat:crit_rating
  • amount:913.59

Stack Uptimes

  • conch_of_dark_whispers_1:23.65%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271071
  • name:Conch of Dark Whispers
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc271072=Your spells have a chance to grant you {$271071s1=649} Critical Strike for {$271071d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of Endless Fathoms 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_flask_of_endless_fathoms
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:238.00

Stack Uptimes

  • flask_of_endless_fathoms_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:251837
  • name:Flask of Endless Fathoms
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=238} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Ignition Mage's Fuse 2.9 0.0 120.3sec 120.3sec 19.17% 0.00% 2.8(2.8) 2.8

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_ignition_mages_fuse
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:4.00
  • associated item:Ignition Mage's Fuse

Stat Buff details

  • stat:haste_rating
  • amount:366.08

Stack Uptimes

  • ignition_mages_fuse_1:3.94%
  • ignition_mages_fuse_2:3.89%
  • ignition_mages_fuse_3:3.83%
  • ignition_mages_fuse_4:3.78%
  • ignition_mages_fuse_5:3.73%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271115
  • name:Ignition Mage's Fuse
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc271117=Ignite the fuse, gaining {$271115s1=260} Haste every $t1 sec. Haste is removed after {$d=20 seconds}.}
  • max_stacks:5
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lifeblood 29.0 0.0 39.9sec 10.4sec 94.55% 0.00% 6.7(7.2) 5.1

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_lifeblood
  • max_stacks:4
  • duration:18.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:asynchronous
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:intellect
  • amount:229.17

Stack Uptimes

  • lifeblood_1:35.86%
  • lifeblood_2:19.96%
  • lifeblood_3:11.49%
  • lifeblood_4:27.23%

Trigger Attempt Success

  • trigger_pct:99.89%

Spelldata details

  • id:295137
  • name:Lifeblood
  • tooltip:$?a162700[Agility]?a162702[Strength]?a162697[Agility]?a162698[Strength]?a162699[Intellect]?a162701[Intellect][primary stat] increased by ${$w1+$w2+$w3}.
  • description:{$@spelldesc295078=Every {$s4=18}-{$s1=25} sec, a Lifeblood Shard erupts from the nearby ground for {$295114d=12 seconds}.$?!s295186&a295078[ $@spellicon295078$@spellname295114 Grants you and any other ally using Worldvein Resonance {$295078s5=55} primary stat while within ${$m2*(1+($295160m1/100))} yds of the Lifeblood Shard. You can benefit from a maximum of {$295137u=4} Lifeblood Shards at a time.][]}
  • max_stacks:4
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Lunar Empowerment 34.0 45.6 8.9sec 3.8sec 81.79% 99.69% 1.9(1.9) 0.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_lunar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • lunar_empowerment_1:36.34%
  • lunar_empowerment_2:31.52%
  • lunar_empowerment_3:13.93%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:Your next Lunar Strike deals $w1% increased damage and has $w2% reduced cast time.
  • description:Increases the damage of your next Lunar Strike by {$s1=20}% and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Moonkin Form 1.0 0.0 0.0sec 0.0sec 100.00% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Spell damage increased by {$s9=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing the damage of your spells by {$s9=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance to make your next Lunar Strike instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Nature's Balance 1.0 0.0 0.0sec 0.0sec 100.00% 0.00% 399.0(399.0) 0.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_natures_balance
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:pandemic
  • stack behavior:default
  • tick behavior:clip
  • tick_time behavior:unhasted
  • period:0.75

Stack Uptimes

  • natures_balance_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202430
  • name:Nature's Balance
  • tooltip:Grants $m3 Astral Power every $m4 sec while in combat or while below 50 Astral Power.
  • description:While in combat you generate $m3 Astral Power every $m4 sec. While out of combat your Astral Power rebalances to 50 instead of depleting to empty.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Overwhelming Power 4.5 3.5 64.6sec 33.8sec 47.98% 0.00% 3.5(48.7) 0.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_overwhelming_power
  • max_stacks:25
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stat Buff details

  • stat:haste_rating
  • amount:31.00

Stack Uptimes

  • overwhelming_power_1:1.37%
  • overwhelming_power_2:1.41%
  • overwhelming_power_3:1.45%
  • overwhelming_power_4:1.49%
  • overwhelming_power_5:1.53%
  • overwhelming_power_6:1.58%
  • overwhelming_power_7:1.62%
  • overwhelming_power_8:1.67%
  • overwhelming_power_9:1.71%
  • overwhelming_power_10:1.76%
  • overwhelming_power_11:1.82%
  • overwhelming_power_12:1.87%
  • overwhelming_power_13:1.93%
  • overwhelming_power_14:1.99%
  • overwhelming_power_15:2.04%
  • overwhelming_power_16:2.10%
  • overwhelming_power_17:2.17%
  • overwhelming_power_18:2.23%
  • overwhelming_power_19:2.30%
  • overwhelming_power_20:2.37%
  • overwhelming_power_21:2.44%
  • overwhelming_power_22:2.52%
  • overwhelming_power_23:2.59%
  • overwhelming_power_24:2.66%
  • overwhelming_power_25:1.35%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:271711
  • name:Overwhelming Power
  • tooltip:Haste increased by $w1. Every second and every time you take damage, this effect is reduced.
  • description:{$@spelldesc266180=Your damaging abilities have a chance to grant you 25 applications of Overwhelming Power. Each stack of Overwhelming Power grants {$s1=0} Haste. An application of Overwhelming Power is removed every 1 sec or whenever you take damage.}
  • max_stacks:25
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
Solar Empowerment 24.5 51.7 12.1sec 3.9sec 85.50% 79.69% 0.3(0.3) 0.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_solar_empowerment
  • max_stacks:3
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • solar_empowerment_1:28.03%
  • solar_empowerment_2:39.56%
  • solar_empowerment_3:17.92%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:Your next Solar Wrath explodes for an additional $w1% of its damage to all nearby enemies and has $w2% reduced cast time.
  • description:Causes your next Solar Wrath to explode for an additional {$s1=20}% of its damage to all nearby enemies and reduces its cast time by {$s2=15}%.
  • max_stacks:1
  • duration:45.00
  • cooldown:0.00
  • default_chance:100.00%
Starlord 15.2 45.7 20.3sec 4.9sec 97.05% 92.04% 15.8(15.8) 11.3

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_starlord
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.03
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:disabled
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • starlord_1:14.80%
  • starlord_2:22.30%
  • starlord_3:59.96%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:279709
  • name:Starlord
  • tooltip:Haste increased by {$s1=3}%.
  • description:{$@spelldesc202345=Starsurge and Starfall grant you {$279709s1=3}% Haste for {$279709d=20 seconds}. Stacks up to {$279709u=3} times. Gaining a stack does not refresh the duration.}
  • max_stacks:3
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Torrent of Elements 4.3 1.2 61.2sec 45.7sec 23.63% 0.00% 1.2(1.2) 4.0

Buff details

  • buff initial source:worldvein
  • cooldown name:buff_torrent_of_elements
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:false
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • torrent_of_elements_1:23.63%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:267685
  • name:Torrent of Elements
  • tooltip:Increases elemental damage done by spells by $s%.
  • description:{$@spelldesc255129=Permanently enchant a weapon to sometimes increase your elemental spell damage by $267685s%.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
worldvein
starsurge Astral Power 60.9 2435.6 40.0 40.0 1720.5
Resource Gains Type Count Total Average Overflow
solar_wrath Astral Power 93.33 746.61 (31.13%) 8.00 0.05 0.01%
celestial_alignment Astral Power 2.00 80.00 (3.34%) 40.00 0.00 0.00%
sunfire Astral Power 18.03 54.10 (2.26%) 3.00 0.00 0.00%
shooting_stars Astral Power 44.50 177.99 (7.42%) 4.00 0.01 0.01%
moonfire Astral Power 14.02 42.07 (1.75%) 3.00 0.00 0.00%
stellar_flare Astral Power 12.74 101.90 (4.25%) 8.00 0.00 0.00%
lunar_strike Astral Power 76.71 920.47 (38.38%) 12.00 0.05 0.01%
natures_balance Astral Power 400.01 200.00 (8.34%) 0.50 0.00 0.00%
arcanic_pulsar Astral Power 6.24 74.87 (3.12%) 12.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 8.00 8.13
Combat End Resource Mean Min Max
Mana 20000.00 20000.00 20000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 19.92 0.00 80.50
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Statistics & Data Analysis

Fight Length
Sample Data worldvein Fight Length
Count 15384
Mean 299.63
Minimum 240.01
Maximum 359.99
Spread ( max - min ) 119.97
Range [ ( max - min ) / 2 * 100% ] 20.02%
DPS
Sample Data worldvein Damage Per Second
Count 15384
Mean 40837.84
Minimum 36864.83
Maximum 46128.54
Spread ( max - min ) 9263.70
Range [ ( max - min ) / 2 * 100% ] 11.34%
Standard Deviation 1262.4871
5th Percentile 38851.19
95th Percentile 42989.04
( 95th Percentile - 5th Percentile ) 4137.85
Mean Distribution
Standard Deviation 10.1787
95.00% Confidence Intervall ( 40817.89 - 40857.79 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 37
0.1% Error 3672
0.1 Scale Factor Error with Delta=300 13607
0.05 Scale Factor Error with Delta=300 54425
0.01 Scale Factor Error with Delta=300 1360623
Priority Target DPS
Sample Data worldvein Priority Target Damage Per Second
Count 15384
Mean 40837.84
Minimum 36864.83
Maximum 46128.54
Spread ( max - min ) 9263.70
Range [ ( max - min ) / 2 * 100% ] 11.34%
Standard Deviation 1262.4871
5th Percentile 38851.19
95th Percentile 42989.04
( 95th Percentile - 5th Percentile ) 4137.85
Mean Distribution
Standard Deviation 10.1787
95.00% Confidence Intervall ( 40817.89 - 40857.79 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 37
0.1% Error 3672
0.1 Scale Factor Error with Delta=300 13607
0.05 Scale Factor Error with Delta=300 54425
0.01 Scale Factor Error with Delta=300 1360623
DPS(e)
Sample Data worldvein Damage Per Second (Effective)
Count 15384
Mean 40837.84
Minimum 36864.83
Maximum 46128.54
Spread ( max - min ) 9263.70
Range [ ( max - min ) / 2 * 100% ] 11.34%
Damage
Sample Data worldvein Damage
Count 15384
Mean 12210080.17
Minimum 9460541.51
Maximum 15091148.98
Spread ( max - min ) 5630607.47
Range [ ( max - min ) / 2 * 100% ] 23.06%
DTPS
Sample Data worldvein Damage Taken Per Second
Count 15384
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data worldvein Healing Per Second
Count 15384
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data worldvein Healing Per Second (Effective)
Count 15384
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data worldvein Heal
Count 15384
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data worldvein Healing Taken Per Second
Count 15384
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data worldvein Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data worldveinTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data worldvein Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask
1 0.00 food
2 0.00 augmentation
3 0.00 variable,name=az_ss,value=azerite.streaking_stars.rank
4 0.00 variable,name=az_ap,value=azerite.arcanic_pulsar.rank
5 0.00 variable,name=sf_targets,value=4
6 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
7 0.00 variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
8 0.00 variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
9 0.00 variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
A 0.00 moonkin_form
B 0.00 snapshot_stats
C 0.00 potion
D 0.00 solar_wrath
Default action list Executed every time the actor is available.
# count action,conditions
E 1.00 potion,if=buff.ca_inc.remains>6&active_enemies=1
0.00 potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
0.00 blood_fury,if=buff.ca_inc.up
F 2.00 berserking,if=buff.ca_inc.up
0.00 arcane_torrent,if=buff.ca_inc.up
0.00 lights_judgment,if=buff.ca_inc.up
0.00 fireblood,if=buff.ca_inc.up
0.00 ancestral_call,if=buff.ca_inc.up
0.00 use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
0.00 use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
0.00 use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
0.00 use_item,name=tidestorm_codex,if=equipped.165576
G 2.94 use_items,if=cooldown.ca_inc.remains>30
0.00 blood_of_the_enemy,if=cooldown.ca_inc.remains>30
0.00 memory_of_lucid_dreams
0.00 purifying_blast
0.00 ripple_in_space
0.00 the_unbound_force,if=buff.reckless_force.up|time<5
H 5.47 worldvein_resonance
0.00 warrior_of_elune
0.00 innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
0.00 incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
I 2.00 celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
0.00 fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
0.00 force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
J 2.94 cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
0.00 starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
K 60.89 starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
L 2.99 sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
M 2.77 moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
N 14.58 sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
O 11.25 moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
P 12.74 stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
0.00 new_moon,if=ap_check
0.00 half_moon,if=ap_check
0.00 full_moon,if=ap_check
Q 77.07 lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
R 92.59 solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
S 0.46 sunfire

Sample Sequence

0123456789ACDHKONPIFGKRQKRQKRQRKRQNRQORQRJKPKRQKQQRQRRRRKRKNKRQRMQQKQQPRKRQKNRQRRRRHOKKQRQQRKNPRQRRRQJKRKRKRMQNKQQPQRRRRKKQONQKRQRKQRQPRHKQNRGKRQRKRQOKQQRRQRKNPKQQROKQQRQKQRNRKQRQPKQORRKRQRQRHNKQIEFKRKRQPKRORQRKNRQRQKRLKQQQKQPORQRRRJKNKRQRKQQKRQQOPRHNKRQGKRQRKQRRKQRRQNORPKQKRQKRQLRKQRRRRRQK

Sample Sequence Table

time list # name target resources buffs
Pre precombat 0 flask worldvein 58.0/100: 58% astral_power
Pre precombat 1 food worldvein 58.0/100: 58% astral_power
Pre precombat 2 augmentation worldvein 58.0/100: 58% astral_power
Pre precombat 3 az_ss Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 4 az_ap Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 5 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 6 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 7 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 8 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat 9 sf_targets Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat A moonkin_form Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat C potion Fluffy_Pillow 58.0/100: 58% astral_power
Pre precombat D solar_wrath Fluffy_Pillow 58.0/100: 58% astral_power battle_potion_of_intellect
0:00.000 default H worldvein_resonance Fluffy_Pillow 66.0/100: 66% astral_power lunar_empowerment, battle_potion_of_intellect
0:01.239 default K starsurge Fluffy_Pillow 66.5/100: 67% astral_power bloodlust, lunar_empowerment, lifeblood(3), battle_potion_of_intellect
0:02.193 default O moonfire Fluffy_Pillow 27.0/100: 27% astral_power bloodlust, arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord, lifeblood(3), battle_potion_of_intellect
0:03.118 default N sunfire Fluffy_Pillow 31.0/100: 31% astral_power bloodlust, arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord, lifeblood(3), battle_potion_of_intellect
0:04.044 default P stellar_flare Fluffy_Pillow 34.5/100: 35% astral_power bloodlust, arcanic_pulsar, lunar_empowerment(2), solar_empowerment, starlord, lifeblood(3), battle_potion_of_intellect
0:04.970 default I celestial_alignment Fluffy_Pillow 43.0/100: 43% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, lifeblood(3), battle_potion_of_intellect
0:05.775 default F berserking Fluffy_Pillow 83.5/100: 84% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, lifeblood(3), battle_potion_of_intellect
0:05.775 default G use_items Fluffy_Pillow 83.5/100: 84% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, lifeblood(3), battle_potion_of_intellect
0:05.775 default K starsurge Fluffy_Pillow 83.5/100: 84% astral_power bloodlust, berserking, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, lifeblood(3), battle_potion_of_intellect, ignition_mages_fuse
0:06.530 default R solar_wrath Fluffy_Pillow 44.0/100: 44% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(2), lifeblood(3), battle_potion_of_intellect, ignition_mages_fuse
0:07.286 default Q lunar_strike Fluffy_Pillow 52.5/100: 53% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), lifeblood(3), battle_potion_of_intellect, ignition_mages_fuse
0:08.154 default K starsurge Fluffy_Pillow 65.0/100: 65% astral_power bloodlust, berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), lifeblood(3), battle_potion_of_intellect, ignition_mages_fuse
0:08.907 default R solar_wrath Fluffy_Pillow 29.5/100: 30% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), lifeblood(3), battle_potion_of_intellect, ignition_mages_fuse
0:09.661 default Q lunar_strike Fluffy_Pillow 38.0/100: 38% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), lifeblood(3), battle_potion_of_intellect, ignition_mages_fuse
0:10.505 default K starsurge Fluffy_Pillow 51.0/100: 51% astral_power bloodlust, berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), lifeblood(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:11.259 default R solar_wrath Fluffy_Pillow 11.5/100: 12% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), lifeblood(3), battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.015 default Q lunar_strike Fluffy_Pillow 20.0/100: 20% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(2)
0:12.826 default R solar_wrath Fluffy_Pillow 32.5/100: 33% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(2)
0:13.580 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power bloodlust, berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), starlord(3), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(2)
0:14.333 default R solar_wrath Fluffy_Pillow 1.5/100: 2% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.086 default Q lunar_strike Fluffy_Pillow 10.0/100: 10% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(3), starlord(3), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:15.865 default N sunfire Fluffy_Pillow 30.5/100: 31% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(25), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:16.621 default R solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(24), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:17.375 default Q lunar_strike Fluffy_Pillow 42.5/100: 43% astral_power bloodlust, berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(23), lifeblood(4), battle_potion_of_intellect, ignition_mages_fuse(3)
0:18.130 default O moonfire Fluffy_Pillow 59.0/100: 59% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(22), lifeblood, battle_potion_of_intellect, ignition_mages_fuse(4)
0:18.886 default R solar_wrath Fluffy_Pillow 62.5/100: 63% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(22), lifeblood, battle_potion_of_intellect, ignition_mages_fuse(4)
0:19.639 default Q lunar_strike Fluffy_Pillow 71.0/100: 71% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(21), lifeblood, battle_potion_of_intellect, ignition_mages_fuse(4)
0:20.411 default R solar_wrath Fluffy_Pillow 83.5/100: 84% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, solar_empowerment, starlord(3), overwhelming_power(20), lifeblood, battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.165 default J cancel_buff Fluffy_Pillow 92.0/100: 92% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, starlord(3), overwhelming_power(19), lifeblood, battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.165 default K starsurge Fluffy_Pillow 92.0/100: 92% astral_power bloodlust, arcanic_pulsar(5), celestial_alignment, overwhelming_power(19), lifeblood, battle_potion_of_intellect, ignition_mages_fuse(4)
0:21.920 default P stellar_flare Fluffy_Pillow 56.5/100: 56% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(19), lifeblood, battle_potion_of_intellect, ignition_mages_fuse(5)
0:22.676 default K starsurge Fluffy_Pillow 65.0/100: 65% astral_power bloodlust, arcanic_pulsar(6), celestial_alignment, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(18), lifeblood, battle_potion_of_intellect, ignition_mages_fuse(5)
0:23.429 default R solar_wrath Fluffy_Pillow 25.5/100: 26% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(17), lifeblood, conch_of_dark_whispers, ignition_mages_fuse(5)
0:24.183 default Q lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), overwhelming_power(16), lifeblood, conch_of_dark_whispers, ignition_mages_fuse(5)
0:24.963 default K starsurge Fluffy_Pillow 46.5/100: 47% astral_power bloodlust, arcanic_pulsar(7), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(16), lifeblood, conch_of_dark_whispers, ignition_mages_fuse(5)
0:25.716 default Q lunar_strike Fluffy_Pillow 7.0/100: 7% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(15), lifeblood, conch_of_dark_whispers, ignition_mages_fuse(5)
0:26.588 default Q lunar_strike Fluffy_Pillow 19.5/100: 20% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(14), lifeblood, conch_of_dark_whispers
0:27.647 default R solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment(3), starlord(3), overwhelming_power(13), lifeblood, conch_of_dark_whispers
0:28.403 default Q lunar_strike Fluffy_Pillow 40.5/100: 41% astral_power bloodlust, arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(25), lifeblood, conch_of_dark_whispers
0:29.422 default R solar_wrath Fluffy_Pillow 53.5/100: 54% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment(2), starlord(3), overwhelming_power(24), lifeblood, conch_of_dark_whispers
0:30.178 default R solar_wrath Fluffy_Pillow 66.0/100: 66% astral_power bloodlust, arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(23), conch_of_dark_whispers
0:30.932 default R solar_wrath Fluffy_Pillow 74.5/100: 75% astral_power bloodlust, arcanic_pulsar(8), starlord(3), overwhelming_power(23), conch_of_dark_whispers
0:31.737 default R solar_wrath Fluffy_Pillow 83.0/100: 83% astral_power bloodlust, arcanic_pulsar(8), starlord(3), overwhelming_power(22), conch_of_dark_whispers
0:32.545 default K starsurge Fluffy_Pillow 91.5/100: 92% astral_power bloodlust, arcanic_pulsar(8), starlord(3), overwhelming_power(21), conch_of_dark_whispers
0:33.356 default R solar_wrath Fluffy_Pillow 64.0/100: 64% astral_power bloodlust, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(20), lifeblood, conch_of_dark_whispers
0:34.112 default K starsurge Fluffy_Pillow 72.5/100: 73% astral_power bloodlust, celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(19), lifeblood, conch_of_dark_whispers
0:34.867 default N sunfire Fluffy_Pillow 33.0/100: 33% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(19), lifeblood, conch_of_dark_whispers
0:35.621 default K starsurge Fluffy_Pillow 40.5/100: 41% astral_power bloodlust, arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(18), lifeblood, conch_of_dark_whispers
0:36.377 default R solar_wrath Fluffy_Pillow 1.0/100: 1% astral_power bloodlust, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment(2), starlord(3), overwhelming_power(17), lifeblood, conch_of_dark_whispers
0:37.131 default Q lunar_strike Fluffy_Pillow 13.5/100: 14% astral_power bloodlust, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(16), lifeblood, conch_of_dark_whispers
0:38.046 default R solar_wrath Fluffy_Pillow 26.0/100: 26% astral_power bloodlust, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(15), lifeblood, conch_of_dark_whispers
0:38.800 default M moonfire Fluffy_Pillow 34.5/100: 35% astral_power bloodlust, arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(15), lifeblood
0:39.555 default Q lunar_strike Fluffy_Pillow 38.0/100: 38% astral_power bloodlust, arcanic_pulsar(2), lunar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(14), lifeblood
0:40.615 default Q lunar_strike Fluffy_Pillow 51.0/100: 51% astral_power bloodlust, arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(13), lifeblood
0:41.677 default K starsurge Fluffy_Pillow 63.5/100: 64% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, torrent_of_elements, overwhelming_power(12), lifeblood
0:42.864 default Q lunar_strike Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(11), lifeblood
0:44.335 default Q lunar_strike Fluffy_Pillow 37.5/100: 38% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(9), lifeblood
0:45.817 default P stellar_flare Fluffy_Pillow 50.5/100: 51% astral_power arcanic_pulsar(3), solar_empowerment(3), starlord, torrent_of_elements, overwhelming_power(8), lifeblood
0:46.983 default R solar_wrath Fluffy_Pillow 59.0/100: 59% astral_power arcanic_pulsar(3), solar_empowerment(3), starlord, torrent_of_elements, overwhelming_power(7), lifeblood
0:47.980 default K starsurge Fluffy_Pillow 67.5/100: 68% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord, torrent_of_elements, overwhelming_power(6), lifeblood
0:49.157 default R solar_wrath Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord(2), torrent_of_elements, overwhelming_power(4), lifeblood
0:50.135 default Q lunar_strike Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(3), lifeblood
0:51.605 default K starsurge Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(2)
0:52.763 default N sunfire Fluffy_Pillow 11.0/100: 11% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(25)
0:53.803 default R solar_wrath Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(3), torrent_of_elements, overwhelming_power(24)
0:54.690 default Q lunar_strike Fluffy_Pillow 23.0/100: 23% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(23), conch_of_dark_whispers
0:56.021 default R solar_wrath Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(21), conch_of_dark_whispers
0:56.918 default R solar_wrath Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(25), conch_of_dark_whispers
0:57.801 default R solar_wrath Fluffy_Pillow 57.5/100: 57% astral_power arcanic_pulsar(5), starlord(3), torrent_of_elements, overwhelming_power(24), lifeblood, conch_of_dark_whispers
0:58.843 default R solar_wrath Fluffy_Pillow 66.0/100: 66% astral_power arcanic_pulsar(5), starlord(3), torrent_of_elements, overwhelming_power(23), lifeblood, conch_of_dark_whispers
0:59.889 default H worldvein_resonance Fluffy_Pillow 74.5/100: 75% astral_power arcanic_pulsar(5), starlord(3), torrent_of_elements, overwhelming_power(22), lifeblood, conch_of_dark_whispers
1:01.053 default O moonfire Fluffy_Pillow 75.5/100: 76% astral_power arcanic_pulsar(5), starlord(3), torrent_of_elements, overwhelming_power(20), lifeblood(4), conch_of_dark_whispers
1:02.110 default K starsurge Fluffy_Pillow 79.0/100: 79% astral_power arcanic_pulsar(5), overwhelming_power(19), lifeblood(4), conch_of_dark_whispers
1:03.266 default K starsurge Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment, starlord, overwhelming_power(18), lifeblood(4), conch_of_dark_whispers
1:04.393 default Q lunar_strike Fluffy_Pillow 0.5/100: 1% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(17), lifeblood(4), conch_of_dark_whispers
1:05.795 default R solar_wrath Fluffy_Pillow 13.5/100: 14% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(3), starlord(2), overwhelming_power(16), lifeblood(4), conch_of_dark_whispers
1:06.731 default Q lunar_strike Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment(2), starlord(2), overwhelming_power(15), lifeblood(4), conch_of_dark_whispers
1:08.142 default Q lunar_strike Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(13), lifeblood(4), conch_of_dark_whispers
1:09.562 default R solar_wrath Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(7), solar_empowerment(3), starlord(2), overwhelming_power(12), lifeblood(4), conch_of_dark_whispers
1:10.513 default K starsurge Fluffy_Pillow 57.0/100: 57% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(2), overwhelming_power(11), lifeblood(4)
1:11.635 default N sunfire Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(10), lifeblood(4)
1:12.731 default P stellar_flare Fluffy_Pillow 25.0/100: 25% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(9), lifeblood(4)
1:13.830 default R solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(3), starlord(3), overwhelming_power(8), lifeblood(4)
1:14.768 default Q lunar_strike Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(7), lifeblood(4)
1:16.177 default R solar_wrath Fluffy_Pillow 55.5/100: 56% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), overwhelming_power(5), lifeblood(3)
1:17.124 default R solar_wrath Fluffy_Pillow 64.0/100: 64% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), overwhelming_power(4), lifeblood(3)
1:18.077 default R solar_wrath Fluffy_Pillow 73.0/100: 73% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power(3)
1:19.200 default Q lunar_strike Fluffy_Pillow 81.5/100: 82% astral_power arcanic_pulsar(8), lunar_empowerment, starlord(3), overwhelming_power(2)
1:20.638 default J cancel_buff Fluffy_Pillow 94.5/100: 95% astral_power arcanic_pulsar(8), starlord(3), overwhelming_power
1:20.638 default K starsurge Fluffy_Pillow 94.5/100: 95% astral_power arcanic_pulsar(8), overwhelming_power
1:21.872 default R solar_wrath Fluffy_Pillow 67.5/100: 68% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord
1:22.760 default K starsurge Fluffy_Pillow 76.0/100: 76% astral_power celestial_alignment, lunar_empowerment, starlord, lifeblood
1:23.806 default R solar_wrath Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), lifeblood
1:24.669 default K starsurge Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(2), lifeblood
1:25.687 default R solar_wrath Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(3), lifeblood
1:26.527 default M moonfire Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar(2), celestial_alignment, lunar_empowerment(3), starlord(3), lifeblood
1:27.516 default Q lunar_strike Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(2), lunar_empowerment(3), starlord(3), lifeblood
1:28.965 default N sunfire Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3), lifeblood
1:30.100 default K starsurge Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3), lifeblood
1:31.237 default Q lunar_strike Fluffy_Pillow 3.5/100: 4% astral_power arcanic_pulsar(3), lunar_empowerment(3), solar_empowerment(2), starlord(3), lifeblood
1:32.684 default Q lunar_strike Fluffy_Pillow 16.5/100: 17% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), lifeblood
1:34.132 default P stellar_flare Fluffy_Pillow 29.5/100: 30% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), lifeblood
1:35.268 default Q lunar_strike Fluffy_Pillow 38.5/100: 39% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), lifeblood
1:36.716 default R solar_wrath Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), lifeblood
1:37.682 default R solar_wrath Fluffy_Pillow 60.0/100: 60% astral_power arcanic_pulsar(3), solar_empowerment, starlord(3), lifeblood
1:38.647 default R solar_wrath Fluffy_Pillow 72.5/100: 73% astral_power arcanic_pulsar(3), starlord(3), lifeblood
1:39.783 default R solar_wrath Fluffy_Pillow 81.5/100: 82% astral_power arcanic_pulsar(3), starlord(3), lifeblood
1:40.919 default K starsurge Fluffy_Pillow 90.0/100: 90% astral_power arcanic_pulsar(3)
1:42.157 default K starsurge Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord
1:43.360 default Q lunar_strike Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(2), lifeblood
1:44.848 default O moonfire Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), lifeblood
1:46.016 default N sunfire Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), lifeblood
1:47.186 default Q lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), lifeblood(2)
1:48.672 default K starsurge Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(2), lifeblood(2)
1:49.841 default R solar_wrath Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(3), starlord(3), lifeblood(2)
1:50.808 default Q lunar_strike Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), lifeblood(2)
1:52.254 default R solar_wrath Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), lifeblood(2), conch_of_dark_whispers
1:53.222 default K starsurge Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), lifeblood(2), conch_of_dark_whispers
1:54.360 default Q lunar_strike Fluffy_Pillow 1.0/100: 1% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment(2), starlord(3), lifeblood(2), conch_of_dark_whispers
1:55.807 default R solar_wrath Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(7), solar_empowerment(2), starlord(3), lifeblood(2), conch_of_dark_whispers
1:56.774 default Q lunar_strike Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(3), lifeblood(2), conch_of_dark_whispers
1:58.221 default P stellar_flare Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), lifeblood(2), conch_of_dark_whispers
1:59.358 default R solar_wrath Fluffy_Pillow 44.5/100: 45% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), lifeblood(2), conch_of_dark_whispers
2:00.323 default H worldvein_resonance Fluffy_Pillow 57.0/100: 57% astral_power arcanic_pulsar(7), starlord(3), lifeblood(2), conch_of_dark_whispers
2:01.460 default K starsurge Fluffy_Pillow 57.5/100: 57% astral_power arcanic_pulsar(7), lifeblood(4), conch_of_dark_whispers
2:02.699 default Q lunar_strike Fluffy_Pillow 18.5/100: 19% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord, lifeblood(4), conch_of_dark_whispers
2:04.231 default N sunfire Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord, lifeblood(3), conch_of_dark_whispers
2:05.434 default R solar_wrath Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord, torrent_of_elements, lifeblood(3), conch_of_dark_whispers
2:06.456 default G use_items Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(8), solar_empowerment, starlord, torrent_of_elements, lifeblood(3), conch_of_dark_whispers
2:06.456 default K starsurge Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(8), solar_empowerment, starlord, torrent_of_elements, lifeblood(3), conch_of_dark_whispers, ignition_mages_fuse
2:07.608 default R solar_wrath Fluffy_Pillow 17.0/100: 17% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, lifeblood(3), ignition_mages_fuse
2:08.435 default Q lunar_strike Fluffy_Pillow 25.5/100: 26% astral_power celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements, lifeblood(3), ignition_mages_fuse
2:09.676 default R solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), torrent_of_elements, lifeblood(4), ignition_mages_fuse
2:10.503 default K starsurge Fluffy_Pillow 47.0/100: 47% astral_power celestial_alignment, lunar_empowerment, starlord(2), torrent_of_elements, lifeblood(4), ignition_mages_fuse(2)
2:11.437 default R solar_wrath Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, lifeblood(4), ignition_mages_fuse(2)
2:12.211 default Q lunar_strike Fluffy_Pillow 20.0/100: 20% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), starlord(3), torrent_of_elements, lifeblood(4), ignition_mages_fuse(2)
2:13.368 default O moonfire Fluffy_Pillow 36.5/100: 37% astral_power arcanic_pulsar, lunar_empowerment, starlord(3), torrent_of_elements, lifeblood(4), ignition_mages_fuse(2)
2:14.411 default K starsurge Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar, lunar_empowerment, starlord(3), torrent_of_elements, lifeblood(4), ignition_mages_fuse(2)
2:15.454 default Q lunar_strike Fluffy_Pillow 1.0/100: 1% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment, starlord(3), torrent_of_elements, lifeblood(4), ignition_mages_fuse(3)
2:16.731 default Q lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, lifeblood(4), ignition_mages_fuse(3)
2:18.009 default R solar_wrath Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), torrent_of_elements, lifeblood(4), ignition_mages_fuse(3)
2:18.864 default R solar_wrath Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(2), starlord(3), torrent_of_elements, lifeblood, ignition_mages_fuse(4)
2:19.831 default Q lunar_strike Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(2), lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(25), lifeblood, ignition_mages_fuse(4)
2:20.969 default R solar_wrath Fluffy_Pillow 60.5/100: 61% astral_power arcanic_pulsar(2), starlord(3), torrent_of_elements, overwhelming_power(24), lifeblood, ignition_mages_fuse(4)
2:21.867 default K starsurge Fluffy_Pillow 69.5/100: 70% astral_power arcanic_pulsar(2), torrent_of_elements, overwhelming_power(23), lifeblood, ignition_mages_fuse(4)
2:22.850 default N sunfire Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(22), lifeblood, ignition_mages_fuse(5)
2:23.772 default P stellar_flare Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(21), lifeblood, ignition_mages_fuse(5)
2:24.698 default K starsurge Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(20), lifeblood, ignition_mages_fuse(5)
2:25.627 default Q lunar_strike Fluffy_Pillow 3.0/100: 3% astral_power arcanic_pulsar(4), lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(19), lifeblood, ignition_mages_fuse(5)
2:26.778 default Q lunar_strike Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(18), lifeblood(2)
2:28.172 default R solar_wrath Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(16), lifeblood
2:29.109 default O moonfire Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(15), lifeblood
2:30.215 default K starsurge Fluffy_Pillow 41.0/100: 41% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment, starlord(2), torrent_of_elements, overwhelming_power(14), lifeblood
2:31.325 default Q lunar_strike Fluffy_Pillow 1.5/100: 2% astral_power arcanic_pulsar(5), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(13), lifeblood, conch_of_dark_whispers
2:32.706 default Q lunar_strike Fluffy_Pillow 14.5/100: 14% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(12), lifeblood, conch_of_dark_whispers
2:34.091 default R solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(3), overwhelming_power(10), lifeblood, conch_of_dark_whispers
2:35.022 default Q lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(9), lifeblood, conch_of_dark_whispers
2:36.421 default K starsurge Fluffy_Pillow 49.0/100: 49% astral_power arcanic_pulsar(5), solar_empowerment, starlord(3), overwhelming_power(8), lifeblood, conch_of_dark_whispers
2:37.525 default Q lunar_strike Fluffy_Pillow 10.0/100: 10% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(7), lifeblood, conch_of_dark_whispers
2:38.938 default R solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), overwhelming_power(6), lifeblood, conch_of_dark_whispers
2:39.883 default N sunfire Fluffy_Pillow 31.5/100: 32% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), overwhelming_power(5), lifeblood, conch_of_dark_whispers
2:40.998 default R solar_wrath Fluffy_Pillow 35.0/100: 35% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), overwhelming_power(4), lifeblood, conch_of_dark_whispers
2:41.950 default K starsurge Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(6), overwhelming_power(3), lifeblood, conch_of_dark_whispers
2:43.176 default Q lunar_strike Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord, overwhelming_power, lifeblood, conch_of_dark_whispers
2:44.700 default R solar_wrath Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar(7), solar_empowerment, starlord, conch_of_dark_whispers
2:45.721 default Q lunar_strike Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(7), lunar_empowerment, starlord, conch_of_dark_whispers
2:47.253 default P stellar_flare Fluffy_Pillow 39.5/100: 40% astral_power arcanic_pulsar(7), solar_empowerment, starlord
2:48.455 default K starsurge Fluffy_Pillow 48.0/100: 48% astral_power arcanic_pulsar(7), solar_empowerment, starlord
2:49.657 default Q lunar_strike Fluffy_Pillow 9.0/100: 9% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(2), lifeblood
2:51.147 default O moonfire Fluffy_Pillow 22.0/100: 22% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(2), lifeblood
2:52.316 default R solar_wrath Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(2), lifeblood
2:53.311 default R solar_wrath Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(8), solar_empowerment, starlord(2), overwhelming_power(24), lifeblood
2:54.222 default K starsurge Fluffy_Pillow 43.0/100: 43% astral_power arcanic_pulsar(8), starlord(2), overwhelming_power(23), lifeblood(2)
2:55.301 default R solar_wrath Fluffy_Pillow 15.5/100: 16% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(22), lifeblood(2)
2:56.078 default Q lunar_strike Fluffy_Pillow 24.0/100: 24% astral_power celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(21), lifeblood(2)
2:57.246 default R solar_wrath Fluffy_Pillow 37.0/100: 37% astral_power celestial_alignment, solar_empowerment, starlord(3), overwhelming_power(20), lifeblood(2)
2:58.029 default Q lunar_strike Fluffy_Pillow 45.5/100: 46% astral_power celestial_alignment, starlord(3), overwhelming_power(19), lifeblood(2)
2:59.412 default R solar_wrath Fluffy_Pillow 58.5/100: 59% astral_power celestial_alignment, starlord(3), overwhelming_power(18), lifeblood(2)
3:00.339 default H worldvein_resonance Fluffy_Pillow 67.0/100: 67% astral_power celestial_alignment, starlord(3), overwhelming_power(17), lifeblood(2)
3:01.268 default N sunfire Fluffy_Pillow 67.5/100: 68% astral_power starlord(3), overwhelming_power(16), lifeblood(4)
3:02.340 default K starsurge Fluffy_Pillow 71.5/100: 72% astral_power overwhelming_power(15), lifeblood(4)
3:03.511 default Q lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power arcanic_pulsar, lunar_empowerment, solar_empowerment, starlord, overwhelming_power(14), lifeblood(4), conch_of_dark_whispers
3:04.965 default I celestial_alignment Fluffy_Pillow 45.0/100: 45% astral_power arcanic_pulsar, solar_empowerment, starlord, overwhelming_power(13), lifeblood(4), conch_of_dark_whispers
3:05.966 default E potion Fluffy_Pillow 85.5/100: 86% astral_power arcanic_pulsar, celestial_alignment, solar_empowerment, starlord, overwhelming_power(12), lifeblood(4), conch_of_dark_whispers
3:05.966 default F berserking Fluffy_Pillow 85.5/100: 86% astral_power arcanic_pulsar, celestial_alignment, solar_empowerment, starlord, overwhelming_power(12), lifeblood(4), conch_of_dark_whispers, battle_potion_of_intellect
3:05.966 default K starsurge Fluffy_Pillow 85.5/100: 86% astral_power berserking, arcanic_pulsar, celestial_alignment, solar_empowerment, starlord, overwhelming_power(12), lifeblood(4), conch_of_dark_whispers, battle_potion_of_intellect
3:06.876 default R solar_wrath Fluffy_Pillow 46.5/100: 47% astral_power berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(11), lifeblood(4), conch_of_dark_whispers, battle_potion_of_intellect
3:07.631 default K starsurge Fluffy_Pillow 55.0/100: 55% astral_power berserking, arcanic_pulsar(2), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(10), lifeblood(4), conch_of_dark_whispers, battle_potion_of_intellect
3:08.523 default R solar_wrath Fluffy_Pillow 15.5/100: 16% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(9), lifeblood(4), conch_of_dark_whispers, battle_potion_of_intellect
3:09.277 default Q lunar_strike Fluffy_Pillow 24.0/100: 24% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(8), lifeblood(4), conch_of_dark_whispers, battle_potion_of_intellect
3:10.390 default P stellar_flare Fluffy_Pillow 36.5/100: 37% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(7), lifeblood(4), conch_of_dark_whispers, battle_potion_of_intellect
3:11.266 default K starsurge Fluffy_Pillow 45.5/100: 46% astral_power berserking, arcanic_pulsar(3), celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(6), lifeblood(4), conch_of_dark_whispers, battle_potion_of_intellect
3:12.142 default R solar_wrath Fluffy_Pillow 6.0/100: 6% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(3), overwhelming_power(5), lifeblood(4), conch_of_dark_whispers, battle_potion_of_intellect
3:12.897 default O moonfire Fluffy_Pillow 14.5/100: 14% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(5), lifeblood(4), conch_of_dark_whispers, battle_potion_of_intellect
3:13.780 default R solar_wrath Fluffy_Pillow 18.0/100: 18% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), overwhelming_power(4), lifeblood(4), conch_of_dark_whispers, battle_potion_of_intellect
3:14.535 default Q lunar_strike Fluffy_Pillow 26.5/100: 27% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment(2), starlord(3), overwhelming_power(3), lifeblood(4), conch_of_dark_whispers, battle_potion_of_intellect
3:15.667 default R solar_wrath Fluffy_Pillow 39.0/100: 39% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power(2), lifeblood(4), conch_of_dark_whispers, battle_potion_of_intellect
3:16.563 default K starsurge Fluffy_Pillow 48.0/100: 48% astral_power berserking, arcanic_pulsar(4), celestial_alignment, lunar_empowerment, starlord(3), overwhelming_power, lifeblood(4), conch_of_dark_whispers, battle_potion_of_intellect
3:17.459 default N sunfire Fluffy_Pillow 8.5/100: 9% astral_power berserking, arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), lifeblood(4), conch_of_dark_whispers, battle_potion_of_intellect
3:18.359 default R solar_wrath Fluffy_Pillow 12.0/100: 12% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(3), lifeblood(4), battle_potion_of_intellect
3:19.200 default Q lunar_strike Fluffy_Pillow 24.5/100: 25% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), lifeblood, battle_potion_of_intellect
3:20.461 default R solar_wrath Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment, starlord(3), lifeblood, battle_potion_of_intellect
3:21.449 default Q lunar_strike Fluffy_Pillow 54.0/100: 54% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment(2), starlord(3), lifeblood(2), battle_potion_of_intellect
3:22.708 default K starsurge Fluffy_Pillow 67.0/100: 67% astral_power arcanic_pulsar(5), celestial_alignment, lunar_empowerment, lifeblood(2), battle_potion_of_intellect
3:23.787 default R solar_wrath Fluffy_Pillow 27.5/100: 28% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord, lifeblood(3), battle_potion_of_intellect
3:24.677 default L sunfire Fluffy_Pillow 36.0/100: 36% astral_power arcanic_pulsar(6), celestial_alignment, lunar_empowerment(2), starlord, lifeblood(3), battle_potion_of_intellect
3:25.725 default K starsurge Fluffy_Pillow 40.0/100: 40% astral_power arcanic_pulsar(6), lunar_empowerment(2), starlord, lifeblood(3), battle_potion_of_intellect
3:26.928 default Q lunar_strike Fluffy_Pillow 0.5/100: 1% astral_power arcanic_pulsar(7), lunar_empowerment(3), solar_empowerment, starlord(2), lifeblood(3), battle_potion_of_intellect
3:28.415 default Q lunar_strike Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar(7), lunar_empowerment(2), solar_empowerment, starlord(2), lifeblood(2), battle_potion_of_intellect
3:29.903 default Q lunar_strike Fluffy_Pillow 34.5/100: 35% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(2), lifeblood(2), battle_potion_of_intellect
3:31.392 default K starsurge Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(7), solar_empowerment, starlord(2), lifeblood(2)
3:32.562 default Q lunar_strike Fluffy_Pillow 8.5/100: 9% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment(2), starlord(3), lifeblood(2)
3:34.009 default P stellar_flare Fluffy_Pillow 21.5/100: 22% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), lifeblood(2)
3:35.146 default O moonfire Fluffy_Pillow 30.0/100: 30% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), lifeblood(2)
3:36.284 default R solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), lifeblood(2)
3:37.252 default Q lunar_strike Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, lifeblood(2)
3:38.699 default R solar_wrath Fluffy_Pillow 59.5/100: 60% astral_power arcanic_pulsar(8), solar_empowerment(2), starlord(3), torrent_of_elements, lifeblood(2)
3:39.666 default R solar_wrath Fluffy_Pillow 72.0/100: 72% astral_power arcanic_pulsar(8), solar_empowerment, starlord(3), torrent_of_elements, lifeblood
3:40.634 default R solar_wrath Fluffy_Pillow 81.0/100: 81% astral_power arcanic_pulsar(8), starlord(3), torrent_of_elements, lifeblood
3:41.773 default J cancel_buff Fluffy_Pillow 89.5/100: 90% astral_power arcanic_pulsar(8), starlord(3), torrent_of_elements, lifeblood
3:41.773 default K starsurge Fluffy_Pillow 89.5/100: 90% astral_power arcanic_pulsar(8), torrent_of_elements, lifeblood
3:43.012 default N sunfire Fluffy_Pillow 62.5/100: 63% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, lifeblood
3:44.058 default K starsurge Fluffy_Pillow 66.0/100: 66% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, lifeblood
3:45.103 default R solar_wrath Fluffy_Pillow 27.0/100: 27% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, lifeblood
3:45.968 default Q lunar_strike Fluffy_Pillow 35.5/100: 36% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(3), solar_empowerment, starlord(2), torrent_of_elements, lifeblood
3:47.265 default R solar_wrath Fluffy_Pillow 48.5/100: 49% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment(2), starlord(2), torrent_of_elements, lifeblood
3:48.130 default K starsurge Fluffy_Pillow 57.0/100: 57% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment(2), solar_empowerment, starlord(2), torrent_of_elements, lifeblood
3:49.147 default Q lunar_strike Fluffy_Pillow 17.5/100: 18% astral_power arcanic_pulsar(2), lunar_empowerment(3), solar_empowerment(2), starlord(3), torrent_of_elements, lifeblood
3:50.595 default Q lunar_strike Fluffy_Pillow 30.5/100: 31% astral_power arcanic_pulsar(2), lunar_empowerment(2), solar_empowerment(2), starlord(3), torrent_of_elements, lifeblood
3:52.044 default K starsurge Fluffy_Pillow 43.5/100: 44% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment(2), starlord(3), lifeblood
3:53.179 default R solar_wrath Fluffy_Pillow 4.0/100: 4% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(3), starlord(3), lifeblood
3:54.145 default Q lunar_strike Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar(3), lunar_empowerment(2), solar_empowerment(2), starlord(3), lifeblood
3:55.592 default Q lunar_strike Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar(3), lunar_empowerment, solar_empowerment(2), starlord(3), lifeblood
3:57.039 default O moonfire Fluffy_Pillow 39.0/100: 39% astral_power arcanic_pulsar(3), solar_empowerment(3), starlord(3), lifeblood
3:58.176 default P stellar_flare Fluffy_Pillow 42.5/100: 43% astral_power arcanic_pulsar(3), solar_empowerment(3), starlord(3), lifeblood(2)
3:59.313 default R solar_wrath Fluffy_Pillow 51.5/100: 52% astral_power arcanic_pulsar(3), solar_empowerment(3), starlord(3), lifeblood
4:00.281 default H worldvein_resonance Fluffy_Pillow 60.0/100: 60% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), lifeblood
4:01.476 default N sunfire Fluffy_Pillow 60.5/100: 61% astral_power arcanic_pulsar(3), solar_empowerment(2), starlord(3), lifeblood(4)
4:02.611 default K starsurge Fluffy_Pillow 64.5/100: 65% astral_power arcanic_pulsar(3), solar_empowerment(2), lifeblood(4)
4:03.850 default R solar_wrath Fluffy_Pillow 25.5/100: 26% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(3), starlord, lifeblood(4)
4:04.870 default Q lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power arcanic_pulsar(4), lunar_empowerment, solar_empowerment(2), starlord, lifeblood(4)
4:06.400 default G use_items Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord, overwhelming_power(25), lifeblood(4)
4:06.400 default K starsurge Fluffy_Pillow 51.0/100: 51% astral_power arcanic_pulsar(4), solar_empowerment(2), starlord, overwhelming_power(25), lifeblood(4), ignition_mages_fuse
4:07.456 default R solar_wrath Fluffy_Pillow 11.5/100: 12% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(3), starlord(2), overwhelming_power(24), lifeblood(4), ignition_mages_fuse
4:08.332 default Q lunar_strike Fluffy_Pillow 20.5/100: 21% astral_power arcanic_pulsar(5), lunar_empowerment, solar_empowerment(2), starlord(2), overwhelming_power(23), lifeblood(4), ignition_mages_fuse
4:09.648 default R solar_wrath Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(5), solar_empowerment(2), starlord(2), overwhelming_power(22), lifeblood(4), ignition_mages_fuse
4:10.529 default K starsurge Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar(5), solar_empowerment, starlord(2), overwhelming_power(21), lifeblood(4), ignition_mages_fuse(2)
4:11.529 default Q lunar_strike Fluffy_Pillow 2.5/100: 3% astral_power arcanic_pulsar(6), lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(20), lifeblood(4), ignition_mages_fuse(2)
4:12.775 default R solar_wrath Fluffy_Pillow 15.5/100: 16% astral_power arcanic_pulsar(6), solar_empowerment(2), starlord(3), torrent_of_elements, overwhelming_power(19), lifeblood(4), ignition_mages_fuse(2)
4:13.607 default R solar_wrath Fluffy_Pillow 28.0/100: 28% astral_power arcanic_pulsar(6), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(18), lifeblood(4), ignition_mages_fuse(2)
4:14.442 default K starsurge Fluffy_Pillow 40.5/100: 41% astral_power arcanic_pulsar(6), starlord(3), torrent_of_elements, overwhelming_power(17), lifeblood(4), ignition_mages_fuse(3)
4:15.393 default Q lunar_strike Fluffy_Pillow 1.0/100: 1% astral_power arcanic_pulsar(7), lunar_empowerment, solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(16), lifeblood(4), ignition_mages_fuse(3)
4:16.609 default R solar_wrath Fluffy_Pillow 14.0/100: 14% astral_power arcanic_pulsar(7), solar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(15), lifeblood(4), ignition_mages_fuse(3)
4:17.422 default R solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power arcanic_pulsar(7), starlord(3), torrent_of_elements, overwhelming_power(14), lifeblood(4), ignition_mages_fuse(3)
4:18.382 default Q lunar_strike Fluffy_Pillow 31.0/100: 31% astral_power arcanic_pulsar(7), lunar_empowerment, starlord(3), torrent_of_elements, overwhelming_power(13), lifeblood, ignition_mages_fuse(3)
4:19.609 default N sunfire Fluffy_Pillow 44.0/100: 44% astral_power arcanic_pulsar(7), starlord(3), torrent_of_elements, overwhelming_power(12), lifeblood, ignition_mages_fuse(4)
4:20.540 default O moonfire Fluffy_Pillow 47.5/100: 48% astral_power arcanic_pulsar(7), starlord(3), torrent_of_elements, overwhelming_power(11), lifeblood, ignition_mages_fuse(4)
4:21.473 default R solar_wrath Fluffy_Pillow 55.0/100: 55% astral_power arcanic_pulsar(7), starlord(3), torrent_of_elements, overwhelming_power(10), lifeblood, ignition_mages_fuse(4)
4:22.409 default P stellar_flare Fluffy_Pillow 63.5/100: 64% astral_power arcanic_pulsar(7), starlord(3), torrent_of_elements, overwhelming_power(9), lifeblood, ignition_mages_fuse(5)
4:23.315 default K starsurge Fluffy_Pillow 72.5/100: 73% astral_power arcanic_pulsar(7), torrent_of_elements, overwhelming_power(8), lifeblood, ignition_mages_fuse(5)
4:24.306 default Q lunar_strike Fluffy_Pillow 33.0/100: 33% astral_power arcanic_pulsar(8), lunar_empowerment, solar_empowerment, starlord, torrent_of_elements, overwhelming_power(7), lifeblood, ignition_mages_fuse(5)
4:25.535 default K starsurge Fluffy_Pillow 50.0/100: 50% astral_power arcanic_pulsar(8), solar_empowerment, starlord, torrent_of_elements, overwhelming_power(6), lifeblood, ignition_mages_fuse(5)
4:26.502 default R solar_wrath Fluffy_Pillow 22.5/100: 23% astral_power celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(2), torrent_of_elements, overwhelming_power(5), lifeblood
4:27.350 default Q lunar_strike Fluffy_Pillow 31.0/100: 31% astral_power celestial_alignment, lunar_empowerment, solar_empowerment, starlord(2), overwhelming_power(4), lifeblood
4:28.625 default K starsurge Fluffy_Pillow 44.0/100: 44% astral_power celestial_alignment, solar_empowerment, starlord(2), overwhelming_power(3), lifeblood
4:29.632 default R solar_wrath Fluffy_Pillow 4.5/100: 5% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment(2), starlord(3), overwhelming_power(2), lifeblood
4:30.466 default Q lunar_strike Fluffy_Pillow 13.0/100: 13% astral_power arcanic_pulsar, celestial_alignment, lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power, lifeblood
4:31.721 default L sunfire Fluffy_Pillow 26.0/100: 26% astral_power arcanic_pulsar, celestial_alignment, solar_empowerment, starlord(3), lifeblood
4:32.710 default R solar_wrath Fluffy_Pillow 33.5/100: 34% astral_power arcanic_pulsar, solar_empowerment, starlord(3), overwhelming_power(25)
4:33.594 default K starsurge Fluffy_Pillow 42.0/100: 42% astral_power arcanic_pulsar, starlord(3), overwhelming_power(24), lifeblood
4:34.636 default Q lunar_strike Fluffy_Pillow 3.0/100: 3% astral_power arcanic_pulsar(2), lunar_empowerment, solar_empowerment, starlord(3), overwhelming_power(23), lifeblood
4:35.968 default R solar_wrath Fluffy_Pillow 19.5/100: 20% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), overwhelming_power(22), lifeblood, conch_of_dark_whispers
4:36.860 default R solar_wrath Fluffy_Pillow 28.5/100: 28% astral_power arcanic_pulsar(2), starlord(3), overwhelming_power(21), lifeblood, conch_of_dark_whispers
4:37.913 default R solar_wrath Fluffy_Pillow 37.0/100: 37% astral_power arcanic_pulsar(2), starlord(3), overwhelming_power(20), lifeblood, conch_of_dark_whispers
4:38.971 default R solar_wrath Fluffy_Pillow 45.5/100: 46% astral_power arcanic_pulsar(2), starlord(3), overwhelming_power(19), lifeblood, conch_of_dark_whispers
4:40.032 default R solar_wrath Fluffy_Pillow 54.5/100: 55% astral_power arcanic_pulsar(2), starlord(3), overwhelming_power(17), lifeblood, conch_of_dark_whispers
4:41.101 default Q lunar_strike Fluffy_Pillow 63.0/100: 63% astral_power arcanic_pulsar(2), lunar_empowerment, starlord(3), overwhelming_power(16), lifeblood, conch_of_dark_whispers
4:42.465 default K starsurge Fluffy_Pillow 76.0/100: 76% astral_power arcanic_pulsar(2), solar_empowerment, starlord(3), overwhelming_power(15), lifeblood, conch_of_dark_whispers

Stats

Level Bonus (120) Race Bonus (troll) Raid-Buffed Unbuffed Gear Amount
Strength 1467 1 1528 1468 0
Agility 1467 2 1529 1469 0
Stamina 1001 0 16238 14762 13761
Intellect 1467 -3 13346 11714 9693 (6045)
Spirit 0 0 0 0 0
Health 324760 295240 0
Mana 20000 20000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 13346 11714 0
Crit 15.68% 15.68% 769
Haste 21.51% 21.51% 1463
Damage / Heal Versatility 4.81% 4.81% 409
ManaReg per Second 2378 640 0
Attack Power 13880 12183 0
Mastery 55.20% 55.20% 2005
Armor 2962 2962 2962
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 447.00
Local Head Hood of the Slithering Loa
ilevel: 450, stats: { 407 Armor, +1145 AgiInt, +2255 Sta }
Local Neck Heart of Azeroth
ilevel: 463, stats: { +325 Haste, +325 Crit, +325 Mastery, +719 Sta, +382 StrAgiInt }
Local Shoulders Gorak Tul's Mantle
ilevel: 450, stats: { 376 Armor, +859 AgiInt, +1691 Sta }
Local Chest Spymaster's Wrap
ilevel: 450, stats: { 501 Armor, +1145 AgiInt, +2255 Sta }
Local Waist Beloved Monarch's Waistwrap
ilevel: 445, stats: { 271 Armor, +431 AgiInt, +789 Sta, +147 Mastery, +82 Crit }
Local Legs Leggings of the Stormborn
ilevel: 445, stats: { 422 Armor, +575 AgiInt, +1053 Sta, +179 Vers, +126 Crit }
Local Feet Ancient Tempest Striders
ilevel: 445, stats: { 331 Armor, +431 AgiInt, +789 Sta, +134 Mastery, +95 Haste }
Local Wrists Tideblood Bracers
ilevel: 445, stats: { 211 Armor, +323 AgiInt, +592 Sta, +105 Haste, +66 Crit }
Local Hands Gloves of Incomparable Beauty
ilevel: 445, stats: { 301 Armor, +431 AgiInt, +789 Sta, +134 Haste, +95 Mastery }
Local Finger1 Boralus Noble's Seal
ilevel: 445, stats: { +592 Sta, +369 Mastery, +169 Haste }, enchant: { +60 Haste }
Local Finger2 Cursed Lover's Ring
ilevel: 445, stats: { +592 Sta, +307 Haste, +230 Vers }, enchant: { +60 Haste }
Local Trinket1 Ignition Mage's Fuse
ilevel: 445, stats: { +546 Int }
Local Trinket2 Conch of Dark Whispers
ilevel: 445, stats: { +546 Int }
Local Back Cloak of Ill Tidings
ilevel: 445, stats: { 142 Armor, +323 StrAgiInt, +592 Sta, +110 Mastery, +61 Crit }
Local Main Hand Anu-Azshara, Staff of the Eternal
ilevel: 445, weapon: { 661 - 896, 3.6 }, stats: { +575 Int, +1053 Sta, +109 Haste, +109 Crit, +109 Mastery, +1981 Int }, enchant: torrent_of_elements

Talents

Level
15 Nature's Balance (Balance Druid) Warrior of Elune (Balance Druid) Force of Nature (Balance Druid)
30 Tiger Dash Renewal Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Starlord (Balance Druid) Incarnation: Chosen of Elune
90 Stellar Drift (Balance Druid) Twin Moons (Balance Druid) Stellar Flare (Balance Druid)
100 Shooting Stars (Balance Druid) Fury of Elune (Balance Druid) New Moon (Balance Druid)

Profile

druid="worldvein"
source=default
spec=balance
level=120
race=troll
role=spell
position=back
talents=1000231
azerite_override=lifespeed:450/heed_my_call:450/overwhelming_power:450/streaking_stars:450/streaking_stars:450/streaking_stars:450/arcanic_pulsar:450/loyal_to_the_end:450/loyal_to_the_end:450

# Default consumables
potion=battle_potion_of_intellect
flask=endless_fathoms
food=bountiful_captains_feast
augmentation=battle_scarred

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask
actions.precombat+=/food
actions.precombat+=/augmentation
actions.precombat+=/variable,name=az_ss,value=azerite.streaking_stars.rank
actions.precombat+=/variable,name=az_ap,value=azerite.arcanic_pulsar.rank
actions.precombat+=/variable,name=sf_targets,value=4
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=talent.starlord.enabled
actions.precombat+=/variable,name=sf_targets,op=add,value=1,if=azerite.streaking_stars.rank>2&azerite.arcanic_pulsar.enabled
actions.precombat+=/variable,name=sf_targets,op=sub,value=1,if=!talent.twin_moons.enabled
actions.precombat+=/moonkin_form
actions.precombat+=/snapshot_stats
actions.precombat+=/potion
actions.precombat+=/solar_wrath

# Executed every time the actor is available.
actions=potion,if=buff.ca_inc.remains>6&active_enemies=1
actions+=/potion,name=battle_potion_of_intellect,if=buff.ca_inc.remains>6
actions+=/blood_fury,if=buff.ca_inc.up
actions+=/berserking,if=buff.ca_inc.up
actions+=/arcane_torrent,if=buff.ca_inc.up
actions+=/lights_judgment,if=buff.ca_inc.up
actions+=/fireblood,if=buff.ca_inc.up
actions+=/ancestral_call,if=buff.ca_inc.up
actions+=/use_item,name=balefire_branch,if=equipped.159630&cooldown.ca_inc.remains>30
actions+=/use_item,name=dread_gladiators_badge,if=equipped.161902&cooldown.ca_inc.remains>30
actions+=/use_item,name=azurethos_singed_plumage,if=equipped.161377&cooldown.ca_inc.remains>30
actions+=/use_item,name=tidestorm_codex,if=equipped.165576
actions+=/use_items,if=cooldown.ca_inc.remains>30
actions+=/blood_of_the_enemy,if=cooldown.ca_inc.remains>30
actions+=/memory_of_lucid_dreams
actions+=/purifying_blast
actions+=/ripple_in_space
actions+=/the_unbound_force,if=buff.reckless_force.up|time<5
actions+=/worldvein_resonance
actions+=/warrior_of_elune
actions+=/innervate,if=azerite.lively_spirit.enabled&(cooldown.incarnation.remains<2|cooldown.celestial_alignment.remains<12)
actions+=/incarnation,if=dot.sunfire.remains>8&dot.moonfire.remains>12&(dot.stellar_flare.remains>6|!talent.stellar_flare.enabled)&ap_check&!buff.ca_inc.up
actions+=/celestial_alignment,if=astral_power>=40&!buff.ca_inc.up&ap_check&(!azerite.lively_spirit.enabled|buff.lively_spirit.up)&(dot.sunfire.remains>2&dot.moonfire.ticking&(dot.stellar_flare.ticking|!talent.stellar_flare.enabled))
actions+=/fury_of_elune,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&solar_wrath.ap_check
actions+=/force_of_nature,if=(buff.ca_inc.up|cooldown.ca_inc.remains>30)&ap_check
actions+=/cancel_buff,name=starlord,if=buff.starlord.remains<3&!solar_wrath.ap_check
actions+=/starfall,if=(buff.starlord.stack<3|buff.starlord.remains>=8)&spell_targets>=variable.sf_targets&(target.time_to_die+1)*spell_targets>cost%2.5
actions+=/starsurge,if=(talent.starlord.enabled&(buff.starlord.stack<3|buff.starlord.remains>=5&buff.arcanic_pulsar.stack<8)|!talent.starlord.enabled&(buff.arcanic_pulsar.stack<8|buff.ca_inc.up))&spell_targets.starfall<variable.sf_targets&buff.lunar_empowerment.stack+buff.solar_empowerment.stack<4&buff.solar_empowerment.stack<3&buff.lunar_empowerment.stack<3&(!variable.az_ss|!buff.ca_inc.up|!prev.starsurge)|target.time_to_die<=execute_time*astral_power%40|!solar_wrath.ap_check
actions+=/sunfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss&dot.moonfire.remains>remains
actions+=/moonfire,if=buff.ca_inc.up&buff.ca_inc.remains<gcd.max&variable.az_ss
actions+=/sunfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=ceil(floor(2%spell_targets)*1.5)+2*spell_targets&(spell_targets>1+talent.twin_moons.enabled|dot.moonfire.ticking)&(!variable.az_ss|!buff.ca_inc.up|!prev.sunfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/moonfire,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))*spell_targets>=6&(!variable.az_ss|!buff.ca_inc.up|!prev.moonfire)&(buff.ca_inc.remains>remains|!buff.ca_inc.up)
actions+=/stellar_flare,target_if=refreshable,if=ap_check&floor(target.time_to_die%(2*spell_haste))>=5&(!variable.az_ss|!buff.ca_inc.up|!prev.stellar_flare)
actions+=/new_moon,if=ap_check
actions+=/half_moon,if=ap_check
actions+=/full_moon,if=ap_check
actions+=/lunar_strike,if=buff.solar_empowerment.stack<3&(ap_check|buff.lunar_empowerment.stack=3)&((buff.warrior_of_elune.up|buff.lunar_empowerment.up|spell_targets>=2&!buff.solar_empowerment.up)&(!variable.az_ss|!buff.ca_inc.up)|variable.az_ss&buff.ca_inc.up&prev.solar_wrath)
actions+=/solar_wrath,if=variable.az_ss<3|!buff.ca_inc.up|!prev.solar_wrath
actions+=/sunfire

head=hood_of_the_slithering_loa,id=159318,ilevel=450
neck=heart_of_azeroth,id=158075,ilevel=463
shoulders=gorak_tuls_mantle,id=159339,ilevel=450
back=cloak_of_ill_tidings,id=168391,ilevel=445
chest=spymasters_wrap,id=155860,ilevel=450
wrists=tideblood_bracers,id=168377,ilevel=445
hands=gloves_of_incomparable_beauty,id=168887,ilevel=445
waist=beloved_monarchs_waistwrap,id=168871,ilevel=445
legs=leggings_of_the_stormborn,id=168378,ilevel=445
feet=ancient_tempest_striders,id=168380,ilevel=445
finger1=boralus_nobles_seal,id=168889,ilevel=445,enchant=60haste
finger2=cursed_lovers_ring,id=168891,ilevel=445,enchant=60haste
trinket1=ignition_mages_fuse,id=159615,ilevel=445
trinket2=conch_of_dark_whispers,id=159620,ilevel=445
main_hand=anuazshara_staff_of_the_eternal,id=168275,ilevel=445,enchant=torrent_of_elements

# Gear Summary
# gear_ilvl=447.20
# gear_stamina=13761
# gear_intellect=9693
# gear_crit_rating=769
# gear_haste_rating=1364
# gear_mastery_rating=1289
# gear_versatility_rating=409
# gear_armor=2962

Simulation & Raid Information

Iterations: 15390
Threads: 6
Confidence: 95.00%
Fight Length (fixed time): 240 - 360 ( 299.6 )

Performance:

Total Events Processed: 351616169
Max Event Queue: 317
Sim Seconds: 4611324
CPU Seconds: 483.1094
Physical Seconds: 91.7752
Speed Up: 9545

Settings:

World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Count Impacts Crit% Avoid% G% B% Interval Combined Duration
base base augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.63sec
base base berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.70sec 0 299.63sec
base base celestial_alignment 194223 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.53sec 0 299.63sec
base base flask 251837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.63sec
base base food 259410 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.63sec
base base heed_my_call 271685 88506 295 1.64 9127 18255 8.2 8.2 18.6% 0.0% 0.0% 0.0% 33.18sec 88506 299.63sec
base base heed_my_call_aoe 271686 37996 127 1.64 3911 7825 8.2 8.2 18.8% 0.0% 0.0% 0.0% 33.18sec 37996 299.63sec
base base lunar_strike 194153 1770080 5908 15.69 19036 38068 78.3 78.3 18.7% 0.0% 0.0% 0.0% 3.74sec 1770080 299.63sec
base base moonfire 8921 54823 183 2.81 3287 6575 14.0 14.0 18.7% 0.0% 0.0% 0.0% 21.43sec 857602 299.63sec
base base moonfire ticks -8921 802778 2676 44.75 3024 6043 14.0 223.8 18.7% 0.0% 0.0% 0.0% 21.43sec 857602 299.63sec
base base moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.63sec
base base potion 279151 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.63sec
base base shooting_stars 202497 275484 919 8.94 5197 10390 44.7 44.7 18.7% 0.0% 0.0% 0.0% 6.57sec 275484 299.63sec
base base solar_wrath 190984 990306 3305 19.23 8690 17368 95.5 96.1 18.7% 0.0% 0.0% 0.0% 3.08sec 990306 299.63sec
base base solar_empowerment 279729 585563 1954 15.10 7766 0 75.4 75.4 0.0% 0.0% 0.0% 0.0% 3.89sec 585563 299.63sec
base base starsurge 78674 4114484 13732 12.39 56002 111931 62.1 61.9 18.8% 0.0% 0.0% 0.0% 4.88sec 4114484 299.63sec
base base stellar_flare 202347 42301 141 2.56 2790 5584 12.8 12.8 18.6% 0.0% 0.0% 0.0% 23.57sec 556965 299.63sec
base base stellar_flare ticks -202347 514665 1716 44.27 1960 3915 12.8 221.4 18.7% 0.0% 0.0% 0.0% 23.57sec 556965 299.63sec
base base streaking_stars 272873 1765518 5892 18.19 16386 32773 90.8 90.8 18.6% 0.0% 0.0% 0.0% 3.08sec 1765518 299.63sec
base base sunfire 93402 94761 316 3.55 4501 8992 17.7 17.7 18.7% 0.0% 0.0% 0.0% 16.86sec 953663 299.63sec
base base sunfire ticks -93402 858902 2863 44.59 3248 6489 17.7 222.9 18.7% 0.0% 0.0% 0.0% 16.86sec 953663 299.63sec
blood of the enemy blood of the enemy augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.63sec
blood of the enemy blood of the enemy berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.67sec 0 299.63sec
blood of the enemy blood of the enemy blood_of_the_enemy 297108 132076 441 0.74 27666 69199 3.7 3.7 19.9% 0.0% 0.0% 0.0% 91.13sec 132076 299.63sec
blood of the enemy blood of the enemy celestial_alignment 194223 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.55sec 0 299.63sec
blood of the enemy blood of the enemy flask 251837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.63sec
blood of the enemy blood of the enemy food 259410 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.63sec
blood of the enemy blood of the enemy heed_my_call 271685 94958 317 1.67 9128 18766 8.4 8.4 23.2% 0.0% 0.0% 0.0% 32.58sec 94958 299.63sec
blood of the enemy blood of the enemy heed_my_call_aoe 271686 40659 136 1.67 3912 8027 8.4 8.4 23.2% 0.0% 0.0% 0.0% 32.58sec 40659 299.63sec
blood of the enemy blood of the enemy lunar_strike 194153 1828440 6102 15.62 18962 38940 78.0 78.0 22.4% 0.0% 0.0% 0.0% 3.74sec 1828440 299.63sec
blood of the enemy blood of the enemy moonfire 8921 57089 191 2.81 3274 6799 14.0 14.0 22.5% 0.0% 0.0% 0.0% 21.44sec 911306 299.63sec
blood of the enemy blood of the enemy moonfire ticks -8921 854217 2847 45.22 3009 6321 14.0 226.1 23.2% 0.0% 0.0% 0.0% 21.44sec 911306 299.63sec
blood of the enemy blood of the enemy moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.63sec
blood of the enemy blood of the enemy potion 279151 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.63sec
blood of the enemy blood of the enemy shooting_stars 202497 293193 979 9.04 5172 10851 45.2 45.2 23.3% 0.0% 0.0% 0.0% 6.47sec 293193 299.63sec
blood of the enemy blood of the enemy solar_wrath 190984 1027356 3429 19.12 8642 17824 95.0 95.5 23.1% 0.0% 0.0% 0.0% 3.10sec 1027356 299.63sec
blood of the enemy blood of the enemy solar_empowerment 279729 612769 2045 15.05 8155 0 75.1 75.1 0.0% 0.0% 0.0% 0.0% 3.89sec 612769 299.63sec
blood of the enemy blood of the enemy starsurge 78674 4335665 14470 12.36 55692 117665 61.9 61.7 23.5% 0.0% 0.0% 0.0% 4.88sec 4335665 299.63sec
blood of the enemy blood of the enemy stellar_flare 202347 44478 148 2.56 2776 5897 12.8 12.8 22.5% 0.0% 0.0% 0.0% 23.57sec 593060 299.63sec
blood of the enemy blood of the enemy stellar_flare ticks -202347 548582 1829 44.76 1950 4099 12.8 223.8 23.3% 0.0% 0.0% 0.0% 23.57sec 593060 299.63sec
blood of the enemy blood of the enemy streaking_stars 272873 1904414 6356 18.00 16393 34156 89.9 89.9 27.0% 0.0% 0.0% 0.0% 3.10sec 1904414 299.63sec
blood of the enemy blood of the enemy sunfire 93402 99025 330 3.57 4487 9280 17.8 17.8 22.3% 0.0% 0.0% 0.0% 16.79sec 1011777 299.63sec
blood of the enemy blood of the enemy sunfire ticks -93402 912751 3043 45.05 3233 6776 17.8 225.2 23.1% 0.0% 0.0% 0.0% 16.79sec 1011777 299.63sec
focusing iris focusing iris augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.63sec
focusing iris focusing iris berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.66sec 0 299.63sec
focusing iris focusing iris celestial_alignment 194223 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.47sec 0 299.63sec
focusing iris focusing iris flask 251837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.63sec
focusing iris focusing iris food 259410 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.63sec
focusing iris focusing iris heed_my_call 271685 93080 311 1.72 9128 18259 8.6 8.6 18.7% 0.0% 0.0% 0.0% 32.09sec 93080 299.63sec
focusing iris focusing iris heed_my_call_aoe 271686 39916 133 1.72 3912 7825 8.6 8.6 18.8% 0.0% 0.0% 0.0% 32.09sec 39916 299.63sec
focusing iris focusing iris lunar_strike 194153 1843448 6152 16.32 19049 38076 81.5 81.5 18.7% 0.0% 0.0% 0.0% 3.59sec 1843448 299.63sec
focusing iris focusing iris moonfire 8921 55083 184 2.84 3273 6545 14.2 14.2 18.7% 0.0% 0.0% 0.0% 21.29sec 893271 299.63sec
focusing iris focusing iris moonfire ticks -8921 838188 2794 46.68 3027 6050 14.2 233.4 18.7% 0.0% 0.0% 0.0% 21.29sec 893271 299.63sec
focusing iris focusing iris moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.63sec
focusing iris focusing iris potion 279151 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.63sec
focusing iris focusing iris shooting_stars 202497 287508 960 9.32 5201 10400 46.5 46.5 18.8% 0.0% 0.0% 0.0% 6.30sec 287508 299.63sec
focusing iris focusing iris solar_wrath 190984 1045909 3491 20.28 8703 17399 100.8 101.3 18.7% 0.0% 0.0% 0.0% 2.92sec 1045909 299.63sec
focusing iris focusing iris solar_empowerment 279729 609434 2034 15.69 7776 0 78.4 78.4 0.0% 0.0% 0.0% 0.0% 3.74sec 609434 299.63sec
focusing iris focusing iris starsurge 78674 4265202 14235 12.85 56040 112002 64.4 64.1 18.7% 0.0% 0.0% 0.0% 4.70sec 4265202 299.63sec
focusing iris focusing iris stellar_flare 202347 42281 141 2.56 2790 5583 12.8 12.8 18.4% 0.0% 0.0% 0.0% 23.56sec 579828 299.63sec
focusing iris focusing iris stellar_flare ticks -202347 537548 1792 46.19 1961 3921 12.8 231.0 18.7% 0.0% 0.0% 0.0% 23.56sec 579828 299.63sec
focusing iris focusing iris streaking_stars 272873 1835970 6127 18.91 16388 32783 94.4 94.4 18.6% 0.0% 0.0% 0.0% 2.98sec 1835970 299.63sec
focusing iris focusing iris sunfire 93402 94004 314 3.53 4497 8994 17.6 17.6 18.6% 0.0% 0.0% 0.0% 17.01sec 990405 299.63sec
focusing iris focusing iris sunfire ticks -93402 896401 2988 46.50 3251 6497 17.6 232.5 18.6% 0.0% 0.0% 0.0% 17.01sec 990405 299.63sec
lucid dreams lucid dreams augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.63sec
lucid dreams lucid dreams berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.08sec 0 299.63sec
lucid dreams lucid dreams celestial_alignment 194223 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 184.35sec 0 299.63sec
lucid dreams lucid dreams flask 251837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.63sec
lucid dreams lucid dreams food 259410 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.63sec
lucid dreams lucid dreams heed_my_call 271685 90597 302 1.66 9229 18458 8.3 8.3 18.7% 0.0% 0.0% 0.0% 32.80sec 90597 299.63sec
lucid dreams lucid dreams heed_my_call_aoe 271686 38792 129 1.66 3955 7912 8.3 8.3 18.6% 0.0% 0.0% 0.0% 32.80sec 38792 299.63sec
lucid dreams lucid dreams lunar_strike 194153 1756930 5864 15.40 19250 38493 76.9 76.9 18.7% 0.0% 0.0% 0.0% 3.79sec 1756930 299.63sec
lucid dreams lucid dreams memory_of_lucid_dreams 298357 0 0 0.00 0 0 2.9 0.0 0.0% 0.0% 0.0% 0.0% 123.01sec 0 299.63sec
lucid dreams lucid dreams moonfire 8921 55375 185 2.84 3288 6575 14.2 14.2 18.7% 0.0% 0.0% 0.0% 21.23sec 872456 299.63sec
lucid dreams lucid dreams moonfire ticks -8921 817081 2724 44.88 3069 6135 14.2 224.4 18.7% 0.0% 0.0% 0.0% 21.23sec 872456 299.63sec
lucid dreams lucid dreams moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.63sec
lucid dreams lucid dreams potion 279151 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.63sec
lucid dreams lucid dreams shooting_stars 202497 280741 937 8.98 5274 10540 44.9 44.9 18.7% 0.0% 0.0% 0.0% 6.49sec 280741 299.63sec
lucid dreams lucid dreams solar_wrath 190984 898592 2999 17.16 8838 17675 85.0 85.7 18.6% 0.0% 0.0% 0.0% 3.45sec 898592 299.63sec
lucid dreams lucid dreams solar_empowerment 279729 638864 2132 16.21 7890 0 81.0 81.0 0.0% 0.0% 0.0% 0.0% 3.61sec 638864 299.63sec
lucid dreams lucid dreams starsurge 78674 4886664 16309 14.50 56906 113701 72.7 72.4 18.6% 0.0% 0.0% 0.0% 4.17sec 4886664 299.63sec
lucid dreams lucid dreams stellar_flare 202347 42659 142 2.56 2816 5630 12.8 12.8 18.6% 0.0% 0.0% 0.0% 23.58sec 566871 299.63sec
lucid dreams lucid dreams stellar_flare ticks -202347 524212 1747 44.42 1989 3976 12.8 222.1 18.7% 0.0% 0.0% 0.0% 23.58sec 566871 299.63sec
lucid dreams lucid dreams streaking_stars 272873 1927121 6432 19.59 16615 33235 97.8 97.8 18.6% 0.0% 0.0% 0.0% 2.88sec 1927121 299.63sec
lucid dreams lucid dreams sunfire 93402 94586 316 3.49 4568 9136 17.4 17.4 18.7% 0.0% 0.0% 0.0% 17.15sec 968650 299.63sec
lucid dreams lucid dreams sunfire ticks -93402 874064 2914 44.72 3294 6585 17.4 223.6 18.7% 0.0% 0.0% 0.0% 17.15sec 968650 299.63sec
purification protocol purification protocol augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.63sec
purification protocol purification protocol berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.55sec 0 299.63sec
purification protocol purification protocol celestial_alignment 194223 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.66sec 0 299.63sec
purification protocol purification protocol flask 251837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.63sec
purification protocol purification protocol food 259410 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.63sec
purification protocol purification protocol heed_my_call 271685 88843 297 1.64 9128 18262 8.2 8.2 18.7% 0.0% 0.0% 0.0% 33.44sec 88843 299.63sec
purification protocol purification protocol heed_my_call_aoe 271686 38100 127 1.64 3912 7824 8.2 8.2 18.8% 0.0% 0.0% 0.0% 33.44sec 38100 299.63sec
purification protocol purification protocol lunar_strike 194153 1735456 5792 15.36 19057 38102 76.7 76.7 18.8% 0.0% 0.0% 0.0% 3.80sec 1735456 299.63sec
purification protocol purification protocol moonfire 8921 54618 182 2.81 3280 6564 14.0 14.0 18.7% 0.0% 0.0% 0.0% 21.37sec 853232 299.63sec
purification protocol purification protocol moonfire ticks -8921 798614 2662 44.55 3022 6039 14.0 222.8 18.7% 0.0% 0.0% 0.0% 21.37sec 853232 299.63sec
purification protocol purification protocol moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.63sec
purification protocol purification protocol potion 279151 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.63sec
purification protocol purification protocol purification_protocol 295293 222566 743 3.34 11227 22456 16.7 16.7 18.7% 0.0% 0.0% 0.0% 17.25sec 222566 299.63sec
purification protocol purification protocol purifying_blast 295337 0 0 0.00 0 0 5.5 0.0 0.0% 0.0% 0.0% 0.0% 60.36sec 0 299.63sec
purification protocol purification protocol purifying_tick ticks -295293 245725 819 0.00 5476 10955 37.9 0.0 18.3% 0.0% 0.0% 0.0% 7.63sec 245725 299.63sec
purification protocol purification protocol shooting_stars 202497 273714 914 8.89 5193 10380 44.4 44.4 18.7% 0.0% 0.0% 0.0% 6.57sec 273714 299.63sec
purification protocol purification protocol solar_wrath 190984 959076 3201 18.60 8699 17387 92.3 92.9 18.7% 0.0% 0.0% 0.0% 3.18sec 959076 299.63sec
purification protocol purification protocol solar_empowerment 279729 574179 1916 14.80 7771 0 73.9 73.9 0.0% 0.0% 0.0% 0.0% 3.96sec 574179 299.63sec
purification protocol purification protocol starsurge 78674 4029848 13449 12.15 55993 111903 60.9 60.7 18.6% 0.0% 0.0% 0.0% 4.95sec 4029848 299.63sec
purification protocol purification protocol stellar_flare 202347 41701 139 2.55 2763 5523 12.7 12.7 18.5% 0.0% 0.0% 0.0% 23.57sec 553488 299.63sec
purification protocol purification protocol stellar_flare ticks -202347 511786 1706 44.05 1958 3914 12.7 220.3 18.7% 0.0% 0.0% 0.0% 23.57sec 553488 299.63sec
purification protocol purification protocol streaking_stars 272873 1742103 5814 17.96 16390 32784 89.7 89.7 18.5% 0.0% 0.0% 0.0% 3.10sec 1742103 299.63sec
purification protocol purification protocol sunfire 93402 96345 322 3.61 4505 9008 18.0 18.0 18.5% 0.0% 0.0% 0.0% 16.50sec 950894 299.63sec
purification protocol purification protocol sunfire ticks -93402 854548 2848 44.38 3246 6487 18.0 221.9 18.7% 0.0% 0.0% 0.0% 16.50sec 950894 299.63sec
ripple in space ripple in space augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.63sec
ripple in space ripple in space berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.56sec 0 299.63sec
ripple in space ripple in space celestial_alignment 194223 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.66sec 0 299.63sec
ripple in space ripple in space flask 251837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.63sec
ripple in space ripple in space food 259410 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.63sec
ripple in space ripple in space heed_my_call 271685 88972 297 1.65 9128 18255 8.2 8.2 18.6% 0.0% 0.0% 0.0% 32.84sec 88972 299.63sec
ripple in space ripple in space heed_my_call_aoe 271686 38179 127 1.65 3912 7826 8.2 8.2 18.7% 0.0% 0.0% 0.0% 32.84sec 38179 299.63sec
ripple in space ripple in space lunar_strike 194153 1777038 5931 15.35 19529 39047 76.7 76.7 18.7% 0.0% 0.0% 0.0% 3.81sec 1777038 299.63sec
ripple in space ripple in space moonfire 8921 56292 188 2.81 3380 6755 14.0 14.0 18.8% 0.0% 0.0% 0.0% 21.38sec 875957 299.63sec
ripple in space ripple in space moonfire ticks -8921 819665 2732 44.54 3102 6200 14.0 222.7 18.7% 0.0% 0.0% 0.0% 21.38sec 875957 299.63sec
ripple in space ripple in space moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.63sec
ripple in space ripple in space potion 279151 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.63sec
ripple in space ripple in space ripple_in_space 302731 125516 419 1.09 23093 0 5.5 5.4 0.0% 0.0% 0.0% 0.0% 60.37sec 125516 299.63sec
ripple in space ripple in space shooting_stars 202497 281171 938 8.90 5332 10657 44.4 44.4 18.7% 0.0% 0.0% 0.0% 6.56sec 281171 299.63sec
ripple in space ripple in space solar_wrath 190984 985808 3290 18.60 8944 17881 92.4 92.9 18.7% 0.0% 0.0% 0.0% 3.18sec 985808 299.63sec
ripple in space ripple in space solar_empowerment 279729 589792 1968 14.79 7985 0 73.9 73.9 0.0% 0.0% 0.0% 0.0% 3.95sec 589792 299.63sec
ripple in space ripple in space starsurge 78674 4124491 13765 12.15 57312 114468 60.9 60.7 18.7% 0.0% 0.0% 0.0% 4.95sec 4124491 299.63sec
ripple in space ripple in space stellar_flare 202347 42629 142 2.55 2822 5642 12.7 12.7 18.6% 0.0% 0.0% 0.0% 23.57sec 567721 299.63sec
ripple in space ripple in space stellar_flare ticks -202347 525092 1750 44.04 2009 4016 12.7 220.2 18.7% 0.0% 0.0% 0.0% 23.57sec 567721 299.63sec
ripple in space ripple in space streaking_stars 272873 1743888 5820 17.96 16387 32776 89.7 89.7 18.6% 0.0% 0.0% 0.0% 3.10sec 1743888 299.63sec
ripple in space ripple in space sunfire 93402 99040 331 3.61 4632 9256 18.0 18.0 18.6% 0.0% 0.0% 0.0% 16.51sec 976129 299.63sec
ripple in space ripple in space sunfire ticks -93402 877090 2924 44.37 3332 6659 18.0 221.8 18.7% 0.0% 0.0% 0.0% 16.51sec 976129 299.63sec
unbound force unbound force augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.63sec
unbound force unbound force berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.65sec 0 299.63sec
unbound force unbound force celestial_alignment 194223 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.73sec 0 299.63sec
unbound force unbound force flask 251837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.63sec
unbound force unbound force food 259410 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.63sec
unbound force unbound force heed_my_call 271685 92434 308 1.65 9128 18269 8.3 8.3 22.5% 0.0% 0.0% 0.0% 32.93sec 92434 299.63sec
unbound force unbound force heed_my_call_aoe 271686 39553 132 1.65 3912 7828 8.3 8.3 22.4% 0.0% 0.0% 0.0% 32.93sec 39553 299.63sec
unbound force unbound force lunar_strike 194153 1770600 5909 15.38 19049 38012 76.8 76.8 21.1% 0.0% 0.0% 0.0% 3.80sec 1770600 299.63sec
unbound force unbound force moonfire 8921 56256 188 2.81 3281 6544 14.0 14.0 22.4% 0.0% 0.0% 0.0% 21.38sec 878734 299.63sec
unbound force unbound force moonfire ticks -8921 822478 2742 44.57 3024 6024 14.0 222.8 22.2% 0.0% 0.0% 0.0% 21.38sec 878734 299.63sec
unbound force unbound force moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.63sec
unbound force unbound force potion 279151 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.63sec
unbound force unbound force shooting_stars 202497 282818 944 8.91 5197 10353 44.5 44.5 22.5% 0.0% 0.0% 0.0% 6.55sec 282818 299.63sec
unbound force unbound force solar_wrath 190984 981998 3277 18.69 8695 17363 92.8 93.3 21.1% 0.0% 0.0% 0.0% 3.16sec 981998 299.63sec
unbound force unbound force solar_empowerment 279729 586427 1957 14.82 7922 0 74.0 74.0 0.0% 0.0% 0.0% 0.0% 3.95sec 586427 299.63sec
unbound force unbound force starsurge 78674 4134715 13799 12.18 55993 111640 61.0 60.8 21.5% 0.0% 0.0% 0.0% 4.94sec 4134715 299.63sec
unbound force unbound force stellar_flare 202347 42914 143 2.55 2766 5527 12.7 12.7 21.8% 0.0% 0.0% 0.0% 23.57sec 569652 299.63sec
unbound force unbound force stellar_flare ticks -202347 526738 1756 44.07 1959 3906 12.7 220.4 22.2% 0.0% 0.0% 0.0% 23.57sec 569652 299.63sec
unbound force unbound force streaking_stars 272873 1765535 5892 17.86 16388 32781 89.2 89.2 20.8% 0.0% 0.0% 0.0% 3.11sec 1765535 299.63sec
unbound force unbound force sunfire 93402 99446 332 3.62 4507 8988 18.1 18.1 22.3% 0.0% 0.0% 0.0% 16.48sec 979102 299.63sec
unbound force unbound force sunfire ticks -93402 879656 2932 44.39 3248 6471 18.1 222.0 22.2% 0.0% 0.0% 0.0% 16.48sec 979102 299.63sec
unbound force unbound force the_unbound_force ticks -298452 401901 1340 7.85 1594 8206 4.9 39.3 76.9% 0.0% 0.0% 0.0% 67.89sec 401901 299.63sec
visions visions augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.63sec
visions visions berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 188.78sec 0 299.63sec
visions visions celestial_alignment 194223 0 0 0.00 0 0 2.5 0.0 0.0% 0.0% 0.0% 0.0% 149.52sec 0 299.63sec
visions visions flask 251837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.63sec
visions visions food 259410 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.63sec
visions visions heed_my_call 271685 91852 307 1.68 9221 18441 8.4 8.4 18.9% 0.0% 0.0% 0.0% 32.71sec 91852 299.63sec
visions visions heed_my_call_aoe 271686 39337 131 1.68 3952 7902 8.4 8.4 18.8% 0.0% 0.0% 0.0% 32.71sec 39337 299.63sec
visions visions lunar_strike 194153 1855585 6193 15.97 19611 39208 79.7 79.7 18.7% 0.0% 0.0% 0.0% 3.68sec 1855585 299.63sec
visions visions moonfire 8921 56499 189 2.85 3338 6679 14.3 14.3 18.7% 0.0% 0.0% 0.0% 21.20sec 899913 299.63sec
visions visions moonfire ticks -8921 843414 2811 45.62 3116 6228 14.3 228.1 18.7% 0.0% 0.0% 0.0% 21.20sec 899913 299.63sec
visions visions moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.63sec
visions visions potion 279151 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.63sec
visions visions shooting_stars 202497 289693 967 9.12 5358 10704 45.5 45.5 18.8% 0.0% 0.0% 0.0% 6.41sec 289693 299.63sec
visions visions solar_wrath 190984 1008335 3365 18.91 8997 17992 93.9 94.4 18.7% 0.0% 0.0% 0.0% 3.14sec 1008335 299.63sec
visions visions solar_empowerment 279729 638685 2132 15.93 8029 0 79.5 79.5 0.0% 0.0% 0.0% 0.0% 3.69sec 638685 299.63sec
visions visions starsurge 78674 4565614 15237 13.31 57860 115672 66.7 66.5 18.7% 0.0% 0.0% 0.0% 4.53sec 4565614 299.63sec
visions visions stellar_flare 202347 43345 145 2.56 2855 5708 12.8 12.8 18.7% 0.0% 0.0% 0.0% 23.57sec 584293 299.63sec
visions visions stellar_flare ticks -202347 540948 1803 45.13 2020 4037 12.8 225.7 18.7% 0.0% 0.0% 0.0% 23.57sec 584293 299.63sec
visions visions streaking_stars 272873 2655650 8863 27.06 16562 33125 135.1 135.1 18.7% 0.0% 0.0% 0.0% 2.13sec 2655650 299.63sec
visions visions sunfire 93402 99244 331 3.61 4636 9266 18.1 18.1 18.6% 0.0% 0.0% 0.0% 16.59sec 1001572 299.63sec
visions visions sunfire ticks -93402 902327 3008 45.44 3347 6690 18.1 227.2 18.7% 0.0% 0.0% 0.0% 16.59sec 1001572 299.63sec
worldvein worldvein augmentation 270058 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.63sec
worldvein worldvein berserking 26297 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.58sec 0 299.63sec
worldvein worldvein celestial_alignment 194223 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 182.66sec 0 299.63sec
worldvein worldvein flask 251837 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.63sec
worldvein worldvein food 259410 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.63sec
worldvein worldvein heed_my_call 271685 89140 297 1.65 9128 18252 8.2 8.2 18.7% 0.0% 0.0% 0.0% 33.10sec 89140 299.63sec
worldvein worldvein heed_my_call_aoe 271686 38263 128 1.65 3912 7825 8.2 8.2 18.8% 0.0% 0.0% 0.0% 33.10sec 38263 299.63sec
worldvein worldvein lunar_strike 194153 1806526 6029 15.36 19837 39659 76.7 76.7 18.7% 0.0% 0.0% 0.0% 3.81sec 1806526 299.63sec
worldvein worldvein moonfire 8921 56979 190 2.81 3424 6848 14.0 14.0 18.7% 0.0% 0.0% 0.0% 21.37sec 890213 299.63sec
worldvein worldvein moonfire ticks -8921 833234 2777 44.55 3152 6299 14.0 222.7 18.7% 0.0% 0.0% 0.0% 21.37sec 890213 299.63sec
worldvein worldvein moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.63sec
worldvein worldvein potion 279151 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 299.63sec
worldvein worldvein shooting_stars 202497 286027 955 8.91 5418 10830 44.5 44.5 18.7% 0.0% 0.0% 0.0% 6.56sec 286027 299.63sec
worldvein worldvein solar_wrath 190984 998645 3333 18.59 9065 18119 92.3 92.8 18.7% 0.0% 0.0% 0.0% 3.18sec 998645 299.63sec
worldvein worldvein solar_empowerment 279729 599081 1999 14.79 8109 0 73.9 73.9 0.0% 0.0% 0.0% 0.0% 3.96sec 599081 299.63sec
worldvein worldvein starsurge 78674 4190424 13985 12.15 58237 116400 60.9 60.7 18.6% 0.0% 0.0% 0.0% 4.95sec 4190424 299.63sec
worldvein worldvein stellar_flare 202347 43446 145 2.55 2873 5740 12.7 12.7 18.7% 0.0% 0.0% 0.0% 23.57sec 577283 299.63sec
worldvein worldvein stellar_flare ticks -202347 533837 1779 44.05 2042 4082 12.7 220.2 18.7% 0.0% 0.0% 0.0% 23.57sec 577283 299.63sec
worldvein worldvein streaking_stars 272873 1742634 5816 17.96 16389 32787 89.7 89.7 18.6% 0.0% 0.0% 0.0% 3.10sec 1742634 299.63sec
worldvein worldvein sunfire 93402 100577 336 3.61 4704 9406 18.0 18.0 18.6% 0.0% 0.0% 0.0% 16.51sec 991844 299.63sec
worldvein worldvein sunfire ticks -93402 891266 2971 44.37 3385 6766 18.0 221.9 18.7% 0.0% 0.0% 0.0% 16.51sec 991844 299.63sec
worldvein worldvein worldvein_resonance 295186 0 0 0.00 0 0 5.5 0.0 0.0% 0.0% 0.0% 0.0% 60.36sec 0 299.63sec

Fluffy_Pillow : 0 dps

Results, Spec and Gear

RPS Out RPS In Primary Resource Waiting APM Active Skill
353635.1 0.0 Health 0.00% 0.0 100.0% 100%
Talents

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 0.7 0.0 0.0sec 0.0sec 13.10% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (0 - 10)_1:13.10%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (10 - 20) 0.9 0.0 0.0sec 0.0sec 8.56% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (10 - 20)_1:8.57%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 9.49% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (20 - 30)_1:9.49%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 9.25% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (30 - 40)_1:9.25%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 10.40% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (40 - 50)_1:10.40%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 11.78% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (50 - 60)_1:11.78%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 12.18% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (60 - 70)_1:12.18%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 11.88% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (70 - 80)_1:11.88%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 7.14% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (80 - 90)_1:7.14%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 6.23% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • Health Decade (90 - 100)_1:6.23%

Trigger Attempt Success

  • trigger_pct:100.00%
Blood of the Enemy 2.0 0.0 182.8sec 182.8sec 6.77% 0.00% 0.0(0.0) 2.0

Buff details

  • buff initial source:blood of the enemy
  • cooldown name:buff_blood_of_the_enemy
  • max_stacks:1
  • duration:10.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • blood_of_the_enemy_1:6.77%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:297108
  • name:Blood of the Enemy
  • tooltip:You have a $w2% increased chance to be Critically Hit by the caster.
  • description:The Heart of Azeroth erupts violently, dealing $s1 Shadow damage to enemies within $A1 yds. You gain $m2% critical strike chance against the targets for {$d=10 seconds}$?a297122[, and increases your critical hit damage by $297126m% for {$297126d=5 seconds}][].
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Constant Buffs
Arcane Intellect

Buff details

  • buff initial source:
  • cooldown name:buff_arcane_intellect
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • arcane_intellect_1:100.00%

Spelldata details

  • id:1459
  • name:Arcane Intellect
  • tooltip:Intellect increased by $w1%.
  • description:Infuses the target with brilliance, increasing their Intellect by $s1% for $d. If target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Battle Shout

Buff details

  • buff initial source:
  • cooldown name:buff_battle_shout
  • max_stacks:1
  • duration:0.00
  • cooldown:15.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • battle_shout_1:100.00%

Spelldata details

  • id:6673
  • name:Battle Shout
  • tooltip:Attack power increased by $w1%.
  • description:Increases the attack power of all raid and party members within $a1 yards by $s1% for $d.
  • max_stacks:0
  • duration:3600.00
  • cooldown:15.00
  • default_chance:0.00%
bleeding

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • bleeding_1:100.00%
Chaos Brand

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_chaos_brand
  • max_stacks:1
  • duration:0.00
  • cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • chaos_brand_1:100.00%

Spelldata details

  • id:1490
  • name:Chaos Brand
  • tooltip:Magic damage taken increased by $s1%.
  • description:{$@spelldesc255260=Your damage brands the target, increasing magic damage taken by $1490s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Mortal Wounds

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • mortal_wounds_1:100.00%

Spelldata details

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Mystic Touch

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mystic_touch
  • max_stacks:1
  • duration:0.00
  • cooldown:5.00
  • default_chance:100.00%
  • default_value:0.05
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • mystic_touch_1:100.00%

Spelldata details

  • id:113746
  • name:Mystic Touch
  • tooltip:Physical damage taken increased by $w1%.
  • description:{$@spelldesc8647=Your damage weakens the target, increasing Physical damage taken by $113746s1%.}
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Power Word: Fortitude

Buff details

  • buff initial source:
  • cooldown name:buff_power_word_fortitude
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10
  • activated:true
  • reactable:false
  • reverse:false
  • refresh behavior:duration
  • stack behavior:default
  • tick behavior:none
  • tick_time behavior:unhasted
  • period:-9223372036854776.00

Stack Uptimes

  • power_word_fortitude_1:100.00%

Spelldata details

  • id:21562
  • name:Power Word: Fortitude
  • tooltip:Stamina increased by $w1%.
  • description:Infuses the target with vitality, increasing their Stamina by $s1% for $d. If the target is in your party or raid, all party and raid members will be affected.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Procs

Count Interval

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow
Resource RPS-Gain RPS-Loss
Health 0.00 353635.07
Combat End Resource Mean Min Max

Benefits & Uptimes

Benefits %
Uptimes %

Statistics & Data Analysis

Fight Length
Sample Data Fluffy_Pillow Fight Length
Count 15384
Mean 299.63
Minimum 240.01
Maximum 359.99
Spread ( max - min ) 119.97
Range [ ( max - min ) / 2 * 100% ] 20.02%
DPS
Sample Data Fluffy_Pillow Damage Per Second
Count 15384
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Sample Data Fluffy_Pillow Priority Target Damage Per Second
Count 15384
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DPS(e)
Sample Data Fluffy_Pillow Damage Per Second (Effective)
Count 15384
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Fluffy_Pillow Damage
Count 15384
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Fluffy_Pillow Damage Taken Per Second
Count 15384
Mean 377718.05
Minimum 356992.04
Maximum 401805.93
Spread ( max - min ) 44813.89
Range [ ( max - min ) / 2 * 100% ] 5.93%
Standard Deviation 7231.5181
5th Percentile 366553.64
95th Percentile 389498.93
( 95th Percentile - 5th Percentile ) 22945.29
Mean Distribution
Standard Deviation 58.3035
95.00% Confidence Intervall ( 377603.78 - 377832.32 )
Normalized 95.00% Confidence Intervall ( 99.97% - 100.03% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 15
0.1% Error 1409
0.1 Scale Factor Error with Delta=300 446419
0.05 Scale Factor Error with Delta=300 1785676
0.01 Scale Factor Error with Delta=300 44641896
HPS
Sample Data Fluffy_Pillow Healing Per Second
Count 15384
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS(e)
Sample Data Fluffy_Pillow Healing Per Second (Effective)
Count 15384
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Fluffy_Pillow Heal
Count 15384
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Fluffy_Pillow Healing Taken Per Second
Count 15384
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Fluffy_Pillow Theck-Meloree Index
Count 15384
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Fluffy_PillowTheck-Meloree Index (Effective)
Count 15384
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
MSD
Sample Data Fluffy_Pillow Max Spike Value
Count 3215
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats

Stats

Level Bonus (123) Race Bonus (humanoid) Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0 0 0
Agility 0 0 0 0 0
Stamina 0 0 0 0 0
Intellect 0 0 0 0 0
Spirit 0 0 0 0 0
Health 0 95617668 0
Melee Crit 5.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste 0.00% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 2700 2700 2700
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 3.00% 3.00% 0
Tank-Block 3.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="Fluffy_Pillow"
source=default
spec=unknown
level=123
race=humanoid
role=tank
position=front
talents=0000000

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.


# Gear Summary
# gear_ilvl=0.00

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Count

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Impacts

Average number of impacts against a target (for attacks that hit multiple times per execute) per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Related to max spike damage, 1k TMI is roughly equivalent to 1% of your health. TMI ignores external healing and absorbs. Lower is better.

TMI bin size

Time bin size used to calculate TMI and MSD, in seconds.

Type

Direct or Periodic damage.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Buff Benefit

The percentage of times the buff had a actual benefit for its mainly intended purpose, eg. damage buffed / spell executes.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

TMI Range

This is the range of TMI values containing 95.00% of the data, roughly centered on the mean.

TMI/MSD Window

Window length used to calculate TMI and MSD, in seconds.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 300.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.

\n\n